Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Permyakov S.E., Cherskaya A., Senin I.I. , Zargarov A.A., Shulga-Morskoy S.V. , Alekseev A.M., Zinchenko D.V. , Lipkin V.M., Philippov P.P. , Uversky V.N. , Permyakov E.A. в журнале Protein engineering , издательство Oxford University Press (United Kingdom) , том 13, ? ...

Еще в разделе: (Показать все результаты (>5333) - istina.msu.ru/ )

• Parak F. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Calcium Binding Proteins - журнал | ИСТИНА - Интеллектуальная Система
• Tsvetkov P.O. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Substitution Correlation in sequences of Transcriptional Factors from MerR Family and their Binding Sites Ilya Zharov1 1 Kharkevich Institute for Information Transmission Problems, Russian Academy of Sciences, Moscow, 127994, Russia, peshwalk@gmail.com The MerR family of bacterial transcriptional regulators contains a number of proteins responsible for heavy metal resistance phenotypes: MerR, CueR, HmrR, ZntR, CadR, PbrR, and GolS. ...

Еще в разделе: (Показать все результаты (>149) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/163.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/43.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/40.pdf

... Energy-linked binding of Pi is required for continuous steady-state proton-translocating ATP hydrolysis catalyzed by F0.F1 ATP synthase. ... The data are interpreted to suggest that coupled and uncoupled ATP hydrolysis catalyzed by Fo.F1 ATP synthases proceeds via different intermediates. ... Pi dissociates before ADP during uncoupled ATP hydrolysis, leaving the E.ADP intermediate which is transformed into the inactive ADP(Mg2+)-inhibited form of the enzyme (latent ATPase). ...

Еще в разделе: (Показать все результаты (>67) - biochem.bio.msu.ru/ )

• [Heart fatty acid binding protein in patients hospitalized because of worsening
• Activity of nucleoside diphosphate kinase alpha (NDPK alpha) capable of binding
• Binding of ouabain and marinobufagenin leads to different structural changes in

Электронная библиотека Попечительского совета . ... Hilton H. - Homogeneous linear substitutions . ... Название: Homogeneous linear substitutions . Автор: Hilton H. Язык: . ... Alternate substitution 34 . ... Homogeneous linear substitution 9 . ... Linear differential equations, homogeneous equations 88 . ... Linear differential equations, substitution 9 . Linearly dependent substitutions 78 . ... Substitution 9 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1473) - lib.mexmat.ru/ )

• Queffelec M. - Substitution Dynamical Systems - Spectral Analysis ::
• Поиск книг, содержащих Подстановка совместимая (consistent substitution) ::
• Поиск книг, содержащих Подстановка несовместимая (inconsistent substitution) ::

... Fortran Binding Issues . Up: Language Binding Next: C Binding Issues Previous: Deprecated Names and Functions . MPI-1.1 provided bindings for Fortran 77. MPI-2 retains these bindings but they are now interpreted in the context of the Fortran 90 standard. ... When the term Fortran is used it means Fortran 90. ... All MPI Fortran subroutines have a return code in the last argument. ... The MPI Fortran binding is inconsistent with the Fortran 90 standard in several respects. ... Центры . ...

Еще в разделе: (Показать все результаты (>206) - www.parallel.ru/ )

• C++ Bindings for Status Access | PARALLEL.RU - Информационно-аналитический
• C++ Bindings for Exceptions | PARALLEL.RU - Информационно-аналитический центр
• MPI-1.2 Fortran Bindings | PARALLEL.RU - Информационно-аналитический центр по

<?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE fontconfig SYSTEM "../fonts.dtd"> <!-- /etc/fonts/conf.d/57-dejavu-sans.conf Define aliasing and other fontconfig settings for DejaVu Sans. б? 2006-2008 Nicolas Mailhot <nicolas.mailhot at laposte.net> --> <fontconfig> <!-- Font substitution rules --> <alias binding="same"> <family>Vn Utopia</family> <accept> <family>Vntopia</family> </accept> </alias> </fontconfig>

Еще в разделе: (Показать все результаты (>5698) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-ruby/rrdtool-bindings/
• Index of /pub/gentoo-portage/dev-libs/xapian-bindings/
• Index of /pub/gentoo-portage/dev-ros/python_qt_binding/

... PHP 4 >= 4.0.6) mb_substitute_character -- Set/Get substitution character . ... mb_substitute_character() specifies substitution character when input character encoding is invalid or character code is not exist in output character encoding. Invalid characters may be substituted NULL (no output), string or integer value (Unicode character code value). ... long" : Output character code value (Example: U+3000,JIS+7E7E) . ... If substchar is not set, it returns Unicode value or " none "/" long ". ...

Еще в разделе: (Показать все результаты (>94) - oit.cmc.msu.ru/ )

• Variable substitution in strings

... Prev . Next . ... SUBSTITUTE(text, old, new [,num]) . SUBSTITUTE ????ІНІГ?Ш??ІГ?С @old ІЙ?? @new ІА @text. тХе??ІНІГ?ШІГІЙІМІГ ІК?оІМІНІГІЙ?ЮІГ?С?Р?Ю ?ї @num-ІЗІН?ж ІКІЗ ?Р?УІГ?С?ж ІА?ХІЗ?ЄІВІГІЙІМ?Э @old ІА @text, ІГ?РІИІМ ІЙІГ ?ж?ї??????ІЙІЗ, ?СІЗ ????ІНІГІЙ?ЮІГ?С?Р?Ю ?ї???ЄІВІЗІГ ІА?ХІЗ?ЄІВІГІЙІМІГ. ?ў?С?? ?Ф?жІЙ?ї?дІМ?Ю ?РІЗІАІНІГ?Р?СІМІН?? ?Р Excel. SUBSTITUTE("testing testing","test","wait",2) equals "testing waiting". ...

Еще в разделе: (Показать все результаты (>119) - uneex.lorien.cs.msu.su/ )

• Binding - Apache HTTP Server
• PspoMaterials/LecturesCMC_LinuxShell2008_04 - UNИX
• PspoMaterials/LecturesCMC_LinuxShell2008_04_02VariableSubstitution - UNИX

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1HLV . DNA BINDING PROTEIN/DNA . 1 . 1 . total (1 entries) . 1 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>1539) - monkey.belozersky.msu.ru/ )

• SCOP famyli: TATA-box binding protein (TBP), C-terminal domain
• PDB entries containing domains of the family "Metal binding domain of Ada"
• PDB entries containing domains of the family "LAG1, DNA binding"

All Windows PC GAMESS/Firefly versions are parallel but can work in serial (sequential) mode. ... This library defines a particular implementation of MPI the PC GAMESS will use. At present, there are the following dlls available in the BINDINGS folder of PC GAMESS/Firefly installation directory: . ... The recommended MPI implementation for PC GAMESS/Firefly running in parallel on self-made (non CCS-based) Windows clusters is NT-MPICH. ... Parallel Windows Instructions: NT-MPICH . ...

Еще в разделе: (Показать все результаты (>32) - classic.chem.msu.su/ )

... Two horseradish peroxidase C (HRPC) mutants with substitutions in the active center, i.e., Phe41-->His and Phe143-->Glu, were compared to the wild-type recombinant enzyme expressed in Escherichia coli in terms of the enzymatic activity and stability under irradiation. ... The radiolytic inactivation of the wild-type and mutant forms of recombinant HRP suggested different binding sites for iodide, 2,2'-bis(3-ethylbenzothiasoline-6-sulfonate (ABTS), guaiacol, and O-phenylene diamine. ...

Еще в разделе: (Показать все результаты (>95) - www.enzyme.chem.msu.ru/ )

. To include the output from one command within the command line for another command, enclose the command whose output is to be included within ` backquotes ` . For example: echo The date today is `date +%d/%m/%y` The date today is 17/05/95 . The output from the command date +%d/%m/%y is substituted at the appropriate location within a command line that uses the echo command.

Еще в разделе: (Показать все результаты (>27) - comet.sai.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . ... Configuring Apache to listen on specific addresses and ports. ... When Apache starts, it binds to some port and address on the local machine and waits for incoming requests. ... If you want Apache to handle IPv4 and IPv6 connections with a minimum of sockets, which requires using IPv4-mapped IPv6 addresses, specify the --enable-v4-mapped configure option and use generic Listen directives like the following: . ...

Еще в разделе: (Показать все результаты (>91) - itpm.msu.su/ )

• СжМвПЭ Ц?Ц? С?С? (Binding) - Apache HTTP Server

... A substitution reaction, in which a halogen is replaced by the sulpho group, proceeds upon irradiation of halogenated naphthylamines (4-chloro-1-naphthylamine and 4- bromo-1-naphthylamine) in an aqueous sodium sulphite solution. The substitution reaction is a chain reaction, because the quantum yield of the reaction is higher than unity at a low intensity of absorbed light. ... The reaction of the photosubstitution of a halogen by sulpho group in halonaphthylamines can be sensitized by dyes. ...

Еще в разделе: (Показать все результаты (>329) - chem.msu.ru/ )

• Retention of Polyphenyls and Substituted Polycyclic Aromatic Hydrocarbons in a
• Molecular modelling isomorphous substitutions W on Rh in crystal lattice like
• 9-Silyl(-Germyl, -Stannyl)substituted derivatives of

... Главная -> Фильмы -> The Substitute . ... Фильмы . ... The Substitute . ... Raymond Cruz . ... David Spates . ... Claudia Silva . ... Шейл, уволенный из ЦРУ, выходит на временную работу вместо своей подруги Джейн (Дайен Венора), учительницы одной из средних школ Майами. Здесь он узнает о существовании банды ?К. Р.? ... Солдат удачи` Шейл (Том Беренджер), уволенный из ЦРУ, выходит на временную работу вместо своей подруги Джейн (Дайен Венора), учительницы одной из средних школ Майами. ...

Еще в разделе: (Показать все результаты (>100) - kinfo.ru/ )

• The Sex Substitute 2 - Фильмы - Kinfo.ru
• The Substitute 2: School's Out - Фильмы - Kinfo.ru
• The Substitute: Failure Is N.. - Фильмы - Kinfo.ru

... AC : P0A6X7; P06984; ID IHFA_ECOLI. ... IHF образован двумя субъединицами IHFA и IHFB. ... Ниже приведена а.к. последовательность белка в fasta-формате: >IHFA_ECOLI integration host factor (IHF), DNA-binding protein, alpha subunit MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITAR RVVTFRPGQKLKSRVENASPKDE Ниже отдельно приведено изображение IHFA [pic] рис.2 третичная структура белка IHFA Белок выделен из организма E.Coli, с ДНК которой он связывается. ...

Еще в разделе: (Показать все результаты (>1388) - kodomo.cmm.msu.ru/ )

• Student's numbers
• Функции. GO.
• Starovoytova's page/Второй семестр/SRS

OpenGL Ada Bindings . The software is for OpenGL or Mesa bindings for Ada. The bindings are currently based on Mesa 2.5, and have been tested with GNAT . ... Home Site: . ... Mesa, GNAT . ... See Home Site for Mailing List information . ... SAL Home | Programming | GL/OpenGL Related Libraries Toolkits . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>138) - www.sai.msu.su/ )

• Zen: tprewriter
• ALTER FULLTEXT MAPPING
• SAL- Other Scientific Fields - Chemistry, Biology Related - SCORE

... net] Как победить косяк в Data Binding в Application Settings? . ... В Properties (для каждой split панели) ->Data->Application Settings биндим оба сплиттера. ... Re: [.net] Как победить косяк в Data Binding в Application Settings? [ re: andpar ] . ... Re: [.net] Как победить косяк в Data Binding в Application Settings? [ re: TAS ] . ... Идешь в Properties для splitContainer2 -> Data -> ApplicationSettings -> Splitter Distance выставляешь в HS или свою настройку можно завести. ...

Еще в разделе: (Показать все результаты (>170) - www.snto-msu.net/ )

... net] Как победить косяк в Data Binding в Application Settings? . ... В Properties (для каждой split панели) ->Data->Application Settings биндим оба сплиттера. ... Re: [.net] Как победить косяк в Data Binding в Application Settings? [ re: andpar ] . ... Re: [.net] Как победить косяк в Data Binding в Application Settings? [ re: TAS ] . ... Идешь в Properties для splitContainer2 -> Data -> ApplicationSettings -> Splitter Distance выставляешь в HS или свою настройку можно завести. ...

Еще в разделе: (Показать все результаты (>297) - www.fds-net.ru/ )

An asymptotic method of consequent canonical substitutions of variables in the problem of translational-rotational motion of two rigid bodies. Part I" . ... An asymptotic method of consequent canonical substitutions of variables is considered for the problem of translational-rotational motion of two rigid bodies. A procedure for constructing the first approximation to the exact solution of the system of differential equations modeling the problem under consideration is developed. ...

Еще в разделе: (Показать все результаты (>49) - num-meth.srcc.msu.ru/ )

• "Computation of contribution from the cavity effect to protein-ligand binding