Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Permyakov S.E. , Cherskaya A.M. , Wasserman L.A. , Khokhlova T.I., Senin I.I. , Zargarov A.A., Zinchenko D.V. , Zernii E.Y. , Lipkin V.M. , Philippov P.P. , Uversky V.N. , Permyakov E.A. в журнале Journal of Proteome Research , издательство American Chemical Society (United States) , том 2, ? ...

Еще в разделе: (Показать все результаты (>5230) - istina.msu.ru/ )

• Tsvetkov P.O. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Fortran Binding Issues . Up: Language Binding Next: C Binding Issues Previous: Deprecated Names and Functions . MPI-1.1 provided bindings for Fortran 77. MPI-2 retains these bindings but they are now interpreted in the context of the Fortran 90 standard. ... When the term Fortran is used it means Fortran 90. ... All MPI Fortran subroutines have a return code in the last argument. ... The MPI Fortran binding is inconsistent with the Fortran 90 standard in several respects. ... Центры . ...

Еще в разделе: (Показать все результаты (>371) - www.parallel.ru/ )

• C Binding Issues | PARALLEL.RU - Информационно-аналитический центр по
• Fortran 77 Binding Issues | PARALLEL.RU - Информационно-аналитический центр по
• Defined Constants for C and Fortran | PARALLEL.RU - Информационно-аналитический

... PHP 4 >= 4.0.6) mb_substitute_character -- Set/Get substitution character . ... mb_substitute_character() specifies substitution character when input character encoding is invalid or character code is not exist in output character encoding. Invalid characters may be substituted NULL (no output), string or integer value (Unicode character code value). ... long" : Output character code value (Example: U+3000,JIS+7E7E) . ... If substchar is not set, it returns Unicode value or " none "/" long ". ...

Еще в разделе: (Показать все результаты (>352) - oit.cmc.msu.ru/ )

• ldap_bind
• yp_get_default_domain
• Variable substitution in strings

Substitution Correlation in sequences of Transcriptional Factors from MerR Family and their Binding Sites Ilya Zharov1 1 Kharkevich Institute for Information Transmission Problems, Russian Academy of Sciences, Moscow, 127994, Russia, peshwalk@gmail.com The MerR family of bacterial transcriptional regulators contains a number of proteins responsible for heavy metal resistance phenotypes: MerR, CueR, HmrR, ZntR, CadR, PbrR, and GolS. ...

Еще в разделе: (Показать все результаты (>152) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/163.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/43.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/40.pdf

Электронная библиотека Попечительского совета . ... McLaughlin J. - Successive Bifurcations Leading to Stochastic Behavior . ... Название: Successive Bifurcations Leading to Stochastic Behavior . ... The first bifurcation leads to a periodic state. The second bifurcation leads to phaselocking, if the first mode is sufficiently energetic. A third bifurcation leads to stochastic behavior. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>2720) - lib.mexmat.ru/ )

• Vilenkin N.Ya. - Method of Successive Approximations :: Электронная библиотека
• Barus C. - Channeled Grating Spectra, Obtained in Successive Diffractions ::
• Hilton H. - Homogeneous linear substitutions :: Электронная библиотека

... Energy-linked binding of Pi is required for continuous steady-state proton-translocating ATP hydrolysis catalyzed by F0.F1 ATP synthase. ... The data are interpreted to suggest that coupled and uncoupled ATP hydrolysis catalyzed by Fo.F1 ATP synthases proceeds via different intermediates. ... Pi dissociates before ADP during uncoupled ATP hydrolysis, leaving the E.ADP intermediate which is transformed into the inactive ADP(Mg2+)-inhibited form of the enzyme (latent ATPase). ...

Еще в разделе: (Показать все результаты (>61) - biochem.bio.msu.ru/ )

• [Heart fatty acid binding protein in patients hospitalized because of worsening
• Activity of nucleoside diphosphate kinase alpha (NDPK alpha) capable of binding
• [Prognostic significance of heart fatty acid binding protein in patients with

... Описание вакансии: . We seek a motivated and team-oriented individual who will be a key contributor to the overall success of BIND's chemistry program. ... Experience: . Polymer . ... Experience in synthesis of functional and biodegradable/biocompatible polymers. ... Familiarity with analytical methods for determination of polymer purity including gas chromatography, atomic absorption spectroscopy (ICP-OES/MS) and liquid chromatography (HPLC). ... Experience in peptide synthesis. ...

Еще в разделе: (Показать все результаты (>53) - www.chemport.ru/ )

... Главная -> Фильмы -> Will Success Spoil Rock Hunt.. ... Фильмы . ... Will Success Spoil Rock Hunter? США 1957 . ... John Williams . ... Robert Adler . ... Edith Leslie . ... Edith Russell . ... Mack Williams . ...

Еще в разделе: (Показать все результаты (>113) - kinfo.ru/ )

• The Secrets of Lake Success - Фильмы - Kinfo.ru
• The American Success Company - Фильмы - Kinfo.ru
• Sweet Smell of Success - Фильмы - Kinfo.ru

<?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE fontconfig SYSTEM "../fonts.dtd"> <!-- /etc/fonts/conf.d/57-dejavu-sans.conf Define aliasing and other fontconfig settings for DejaVu Sans. б? 2006-2008 Nicolas Mailhot <nicolas.mailhot at laposte.net> --> <fontconfig> <!-- Font substitution rules --> <alias binding="same"> <family>Vn Utopia</family> <accept> <family>Vntopia</family> </accept> </alias> </fontconfig>

Еще в разделе: (Показать все результаты (>7836) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-ruby/rrdtool-bindings/
• Index of /pub/gentoo-portage/dev-libs/xapian-bindings/
• Index of /pub/gentoo-portage/dev-ros/python_qt_binding/

... Prev . Next . ... SUBSTITUTE(text, old, new [,num]) . SUBSTITUTE ????ІНІГ?Ш??ІГ?С @old ІЙ?? @new ІА @text. тХе??ІНІГ?ШІГІЙІМІГ ІК?оІМІНІГІЙ?ЮІГ?С?Р?Ю ?ї @num-ІЗІН?ж ІКІЗ ?Р?УІГ?С?ж ІА?ХІЗ?ЄІВІГІЙІМ?Э @old ІА @text, ІГ?РІИІМ ІЙІГ ?ж?ї??????ІЙІЗ, ?СІЗ ????ІНІГІЙ?ЮІГ?С?Р?Ю ?ї???ЄІВІЗІГ ІА?ХІЗ?ЄІВІГІЙІМІГ. ?ў?С?? ?Ф?жІЙ?ї?дІМ?Ю ?РІЗІАІНІГ?Р?СІМІН?? ?Р Excel. SUBSTITUTE("testing testing","test","wait",2) equals "testing waiting". ...

Еще в разделе: (Показать все результаты (>138) - uneex.lorien.cs.msu.su/ )

• Binding - Apache HTTP Server
• PspoMaterials/LecturesCMC_LinuxShell2008_04 - UNИX
• PspoMaterials/LecturesCMC_LinuxShell2008_04_02VariableSubstitution - UNИX

... Определяющие факторы и закономерности репродуктивного успеха у большого подковоноса в период восстановления популяции // Determinants and patterns of reproductive success in the greater horseshoe bat during a population recovery: Ward H.L., Ransome R.D., Jones G., Rossiter S.J. ? ... Большие подковоносы ( Rhinolophus ferrumequinum ) демонстрируют пример RSD и самки, по-видимому, сами выбирают полового партнера, когда прилетают в подземные убежища и спариваются там с самцами. ...

Еще в разделе: (Показать все результаты (>236) - zmmu.msu.ru/ )

All Windows PC GAMESS/Firefly versions are parallel but can work in serial (sequential) mode. ... This library defines a particular implementation of MPI the PC GAMESS will use. At present, there are the following dlls available in the BINDINGS folder of PC GAMESS/Firefly installation directory: . ... The recommended MPI implementation for PC GAMESS/Firefly running in parallel on self-made (non CCS-based) Windows clusters is NT-MPICH. ... Parallel Windows Instructions: NT-MPICH . ...

Еще в разделе: (Показать все результаты (>32) - classic.chem.msu.su/ )

. To include the output from one command within the command line for another command, enclose the command whose output is to be included within ` backquotes ` . For example: echo The date today is `date +%d/%m/%y` The date today is 17/05/95 . The output from the command date +%d/%m/%y is substituted at the appropriate location within a command line that uses the echo command.

Еще в разделе: (Показать все результаты (>35) - comet.sai.msu.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1HLV . DNA BINDING PROTEIN/DNA . 1 . 1 . total (1 entries) . 1 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>1540) - monkey.belozersky.msu.ru/ )

• HTH_3_main
• SCOP famyli: TATA-box binding protein (TBP), C-terminal domain
• PDB entries containing domains of the family "Metal binding domain of Ada"

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . ... Configuring Apache to listen on specific addresses and ports. ... When Apache starts, it binds to some port and address on the local machine and waits for incoming requests. ... If you want Apache to handle IPv4 and IPv6 connections with a minimum of sockets, which requires using IPv4-mapped IPv6 addresses, specify the --enable-v4-mapped configure option and use generic Listen directives like the following: . ...

Еще в разделе: (Показать все результаты (>116) - itpm.msu.su/ )

• СжМвПЭ Ц?Ц? С?С? (Binding) - Apache HTTP Server

... Two horseradish peroxidase C (HRPC) mutants with substitutions in the active center, i.e., Phe41-->His and Phe143-->Glu, were compared to the wild-type recombinant enzyme expressed in Escherichia coli in terms of the enzymatic activity and stability under irradiation. ... The radiolytic inactivation of the wild-type and mutant forms of recombinant HRP suggested different binding sites for iodide, 2,2'-bis(3-ethylbenzothiasoline-6-sulfonate (ABTS), guaiacol, and O-phenylene diamine. ...

Еще в разделе: (Показать все результаты (>92) - www.enzyme.chem.msu.ru/ )

... The main objective of our investigations was to examine how the intensity of vegetative growth and reproduction is connected with the success of insect catching and the conditions of inhabitation of different carnivorous plants species. ... In converse to the previous statement, the number of insects caught depends on the size of the plant. ... The success of insect catchings by all of the studied carnivorous plant species depend on weather conditions and total number of insects available. ...

Еще в разделе: (Показать все результаты (>70) - herba.msu.ru/ )

... A substitution reaction, in which a halogen is replaced by the sulpho group, proceeds upon irradiation of halogenated naphthylamines (4-chloro-1-naphthylamine and 4- bromo-1-naphthylamine) in an aqueous sodium sulphite solution. The substitution reaction is a chain reaction, because the quantum yield of the reaction is higher than unity at a low intensity of absorbed light. ... The reaction of the photosubstitution of a halogen by sulpho group in halonaphthylamines can be sensitized by dyes. ...

Еще в разделе: (Показать все результаты (>290) - chem.msu.ru/ )

• Retention of Polyphenyls and Substituted Polycyclic Aromatic Hydrocarbons in a
• Molecular modelling isomorphous substitutions W on Rh in crystal lattice like
• On the reduction behaviour of 2-methoxy and 2-methylthioethyl substituted

OpenGL Ada Bindings . The software is for OpenGL or Mesa bindings for Ada. The bindings are currently based on Mesa 2.5, and have been tested with GNAT . ... Home Site: . ... Mesa, GNAT . ... See Home Site for Mailing List information . ... SAL Home | Programming | GL/OpenGL Related Libraries Toolkits . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>290) - www.sai.msu.su/ )

• WebMuseum: Hockney, David
• APOD: 2005 February 12 - NEAR at Eros: Before Touchdown
• APOD: 2001 August 24 - NEAR at Eros: Before Touchdown

... AC : P0A6X7; P06984; ID IHFA_ECOLI. ... IHF образован двумя субъединицами IHFA и IHFB. ... Ниже приведена а.к. последовательность белка в fasta-формате: >IHFA_ECOLI integration host factor (IHF), DNA-binding protein, alpha subunit MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITAR RVVTFRPGQKLKSRVENASPKDE Ниже отдельно приведено изображение IHFA [pic] рис.2 третичная структура белка IHFA Белок выделен из организма E.Coli, с ДНК которой он связывается. ...

Еще в разделе: (Показать все результаты (>1469) - kodomo.cmm.msu.ru/ )

• Student's numbers
• Функции. GO.
• Starovoytova's page/Второй семестр/SRS