... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Статистика пользователя Independent . ... Posts . ... Network . ...

Еще в разделе: (Показать все результаты (>832) - www.fds-net.ru/ )

• Персональная информация о Independent - Public forum of MSU united student
• Студенты на должность Стажеров - Public forum of MSU united student networks
• Hyundai&Suzuki - Public forum of MSU united student networks

. Список форумов . Персональная информация о Independent . Email . Имя . Титул . enthusiast . Итого сообщений . 231 . Рейтинг . 84 . Домашняя страница . Род занятий . Хобби . Расположение . Биография . Номер ICQ . Пол (gender) . Дата регистрации . 19.10.2003 00:16 . Последний раз онлайн . Подпись . Симпатии . Penalties . Комментарий . Послать личное сообщение | История | Добавить в адресную книгу | Показать все сообщения пользователя | .

Еще в разделе: (Показать все результаты (>398) - www.snto-msu.net/ )

• Студенты на должность Стажеров - Public forum of MSU united student networks
• Установка магнитолы в ВАЗ-2115 - Public forum of MSU united student networks
• Hyundai&Suzuki - Public forum of MSU united student networks

... Calculation of exact frequency-dependent rays when the solution of the Helmholtz equation is known" . Gadylshin K.G. and Protasov M.I. A numerical method is proposed for the calculation of exact frequency-dependent rays when the solution of the Helmholtz equation is known. The properties of frequency-dependent rays are analyzed and compared with the classical ray theory and with the method of finite-difference modeling for the first time. ...

Еще в разделе: (Показать все результаты (>45) - num-meth.srcc.msu.ru/ )

• "The dynamic map of a chromatographic system as a tool to study time-dependent
• "An adaptive grid method for solving the time-dependent Schroedinger equation"
• "A difference scheme for time-dependent gasdynamic equations based on

... Building Packages for Multiple Architectures and Operating Systems . ... The key to exerting this kind of platform-specific control in the spec file is to use RPM's conditionals. ... The first thing is that conditionals are block-structured. ... ifos Linux Summary: This is a package for the Linux operating system %endif . ... ifarch i386 echo "This is an i386" %ifos Linux echo "This is a Linux system" %else echo "This is not a Linux system" %endif %else echo "This is not an i386" %endif . ...

Еще в разделе: (Показать все результаты (>64) - uneex.lorien.cs.msu.su/ )

• Platform-Dependent Tags
• What Does RPM Do To Make Multi-Platform Packaging Easier?

... About lab . ... Selected publications . Publications . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... View-Dependent Octree Image Rendering . Publication Type . Conference Paper . Year of Publication . ... Conference Name . ... Publication Language . ... http://graphics.cs.msu.ru/en/publications/text/gc2003z.pdf . ...

Еще в разделе: (Показать все результаты (>51) - graphics.cs.msu.ru/ )

• View-Dependent Octree Image Rendering | Лаборатория компьютерной графики и
• Generic regularization of boosting-based algorithms for the discovery of
• Generic Regularization of Boosting-Based Optimization for the Discovery of

... Phosphorylation by cyclic AMP-dependent protein kinase inhibits chaperone-like activity of human HSP22 in vitro. ... Human small heat shock protein with molecular mass 22 kD (HSP22, HspB8) contains two Ser residues (Ser24 and Ser57) in consensus sequence RXS and is effectively phosphorylated by cAMP-dependent protein kinase in vitro. ... Thus, phosphorylation by cAMP-dependent protein kinase affects the structure and decreases chaperone-like activity of HSP22 in vitro. ...

Еще в разделе: (Показать все результаты (>58) - biochem.bio.msu.ru/ )

• Redox-dependent change of nucleotide affinity to the active site of the
• Ammonium-dependent hydrogen peroxide production by mitochondria.

sw|Q6FCI2|CLPS_ACIAD ATP-dependent Clp protease adapter protein clpS. ... MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQ LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA >sw|P0A8Q8|CLPS_ECO57 ATP-dependent Clp protease adapter protein clpS. ... MGKNNDWLNFEHLVKDKQIEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQ LMLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEKA >sw|Q1CA97|CLPS_YERPA ATP-dependent Clp protease adapter protein clpS. ...

Еще в разделе: (Показать все результаты (>373) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~aelita/Term2/fasta94_gammaproteobacteria.fasta
• http://kodomo.cmm.msu.ru/~ramil.mintaev/projects/files/otbr_gomologi.txt
• http://kodomo.cmm.msu.ru/~alisikfox90/term2/all.fasta

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... 2015 Determination of the properties of viscoelastic materials using spherical nanoindentation . Martynova E.D. в журнале Mechanics of Time-Dependent Materials , издательство Kluwer Academic Publishers (Netherlands) DOI . ...

Еще в разделе: (Показать все результаты (>949) - istina.msu.ru/ )

• Neurochemistry International - журнал | ИСТИНА - Интеллектуальная Система
• Clauer C.R. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Haloui M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

. Название публикации . Kinase related protein/telokin inhibits microcystin-induced Ca2+-independent contraction in triton skinned guinea pig taenia coli . Авторы . O. Shcherbakova, D. Serebryanaya, A. Postnikov, S. Zittrich, V. Shirinsky, A. Vorotnikov, G. Pfitzer . Дата . 31.12.2009 23:00:00 . Название журнала . Biochem. J. Том . Vol.429. Номер . 2 . первая страница . 291 . последняя страница . 302. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>8) - fbm.msu.ru/ )

ADIFOR . ADIFOR is a tool for the automatic differentiation of Fortran 77 programs. Given a Fortran 77 source code and a user's specification of dependent and independent variables, ADIFOR will generate an augmented derivative code that computes the partial derivatives of all of the specified dependent variables with respect to all of the specified independent variables in addition to the original result. The ADIFOR 2.0 system offers the following features: . ... Numerical Analysis | ...

Еще в разделе: (Показать все результаты (>515) - www.sai.msu.su/ )

• List of Amateurs Discoverers of SNe.
• SAL- Numerical Analysis - Discrete Methods Related Tools - ALBERT
• SN 1994I.

... Invariant Equations for (1+1) Linear Parabolic Equations . ... Semi-invariants for linear parabolic equations in two independent variables and one dependent variable under linear changes of the dependent variable have been investigated in [1]. The joint invariant equation for   (1+1) linear parabolic equations for reduction to the classical heat equation has also been deduced in [2]. We further study reduction for these type of equations   under equivalence transformations. ...

Еще в разделе: (Показать все результаты (>50) - acs366.phys.msu.su/ )

Internet Architecture Board (IAB) N. Brownlee, Ed. Request for Comments: 6548 The University of Auckland Obsoletes: 5620 IAB Category: Informational June 2012 ISSN: 2070-1721 Independent Submission Editor Model Abstract This document describes the function and responsibilities of the RFC Independent Submission Editor (ISE). ... Independent Submission Editor . ... Independent Submission Editorial Board The ISE is supported by an Editorial Board for the review of Independent Submission stream documents. ...

Еще в разделе: (Показать все результаты (>11374) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6548.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/IETFreports/2009/ietf76.pdf
• http://mirror.msu.net/pub/slackware-current/slackware/l/libiodbc-3.52.10-i586-2.txt

Understanding the boundaries between chromosome races of common shrews in terms of restricted movement by individual shrews . ... Data on population density, dispersal and homing in common shrews of the Moscow chromosome race are discussed. ... The boundaries between different chromosome races in continuous forests may be explained in terms of the low probability of dispersal of shrews beyond the area of an independent population. ... Advances in the Biology of Shrews. ... Evolution of Shrews. ...

Еще в разделе: (Показать все результаты (>400) - zmmu.msu.ru/ )

• The в??developmental conduitв?? of the tribe Microtini (Rodentia, Arvicolinae):
• Primitive and derived features in the teeth of modern moose (Alces, Cervidae,

... To define in detail the molecular mechanism of NAD+-dependent formate dehydrogenase, the pH dependences of various kinetic and spectroscopic parameters have been studied: Vmax, Km (NAD+), Km (formate), inhibition constants for structural analogues of substrate (NO3-) and product (CNS-, CNO-, N3-), CD and fluorescence properties. The value of Vmax, rate-limiting hydride transfer, is nearly constant throughout the entire pH range of enzyme stability (6.0-11.2) but decreases below 6. ...

Еще в разделе: (Показать все результаты (>69) - www.enzyme.chem.msu.ru/ )

• Bcm_2004_69_11
• Bcm_2005_70_01
• Biomolecular Engineering 2006