. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1338) - monkey.belozersky.msu.ru/ )

• About this project
• About COGs
• ETS_all_contacts alignment

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>195) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6990) - mouse.belozersky.msu.ru/ )

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>8477) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Fasta
• APOD: 2003 May 27 - A Mercury Transit Sequence

Scoring Matrices . Matrix Sequences Sequence Consisting of the first four Amino Acids in the Protein GYRB_ECOL: . ... Sequence Achieved by Substitution of the 2nd and 4th Amino Acid and Insertion between the 3d and 4th Amino Acid, in the Protein GYRB_ECOLI, to randomly chosen new amino acids: . ... Matrix Sequences Sequence Consisting of the First Nine Amino Acids of the Protein GYRB_ECOLI: . ... Sequence Consisting of 2nd, 3d, 7th, 8th and 9th Amino Acid Residues of the Protein GYRB_ECOLI: . ...

Еще в разделе: (Показать все результаты (>4685) - kodomo.cmm.msu.ru/ )

• Conservative Amino Acid Residues

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>144) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPlight

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>309) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

... 10 import sequence . ... 12 import allpy_data . ... 14 class Project ( object ): . ... 19 * alignment -- dict . ... 27 def __init__ ( self , * args ): . ... 31 Project(sequences, alignment) -> new Project with sequences and . ... 33 Project(fasta_file) -> new Project, read alignment and sequences . ... sequences , self . ... 97 >>> sequences,alignment=project.Project.get_from_fasta(open("test.fasta")) . ... 133 alignment [ sequences [ - 1 ]] = alignment_list . 134 return sequences , alignment . ...

Еще в разделе: (Показать все результаты (>35260) - kodomo.fbb.msu.ru/ )

• allpy: 3a802644d798 test/usecase1.py
• allpy: 2f851b66a2c7 test/usecase1.py
• allpy: 88c246f20918 test/usecase1.py

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>235) - graphics.cs.msu.ru/ )

• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа
• x264 codec improvement | Graphics and Media Lab
• x264 codec improvement | Лаборатория компьютерной графики и мультимедиа

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>55) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Other prospects of the change-point based analysis
• Change-points in multi-channel EEG

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>351) - www.parallel.ru/ )

• Special features of different systems | PARALLEL.RU -
• Difference between workstation clusters and MPPs | PARALLEL.RU -
• Programs fail after starting | PARALLEL.RU - Информационно-аналитический центр

How is threading different from tasks using shared memory? The obvious question many ask is: what is the difference between threading and forks with shared memory. ... Threading . Common Memory . Threads naturally have shared data regions. ... If you clone() with data and stack shared, all subsequent memory allocations can be seen by other threads. ... From thence, shared memory calls WILL FAIL, because the tasks will not be talking about the share memory IDs. ... Previous Page] . ...

Еще в разделе: (Показать все результаты (>446) - rtm-cs.sinp.msu.ru/ )

• Apache IP-based Virtual Host Support
• How to change the title of an xterm

Diploma thesis abstract model describing the recently observed femtosecond oscillations in bacterial photoreaction centers at primary photosynthesis acts is presented. ... Good agree ment between model yield and experimental 150 fe mtosecond oscillations achieved. A set of numerical experiments for different regimes of electron transport was realized. Diploma also contains a comparison between different model approaches using to describe electron transport. ...

Еще в разделе: (Показать все результаты (>113) - ofvp.phys.msu.ru/ )

Pleistocene Climatic Records of East and Central Asia Based on Micromorphological and Mineralogical Indicators of Loess-Paleosol Sequences . ... It is therefore necessary to study the sequences of processes in buried soils to provide information about pedogenesis as well as diagenesis. ... The loess-paleosol sequences of the Luochuan section, Shaanhi, China and of the Karamaydan and Chasmanigar sections in the Tajik Depression are well comparable especially for the Brunches chron. ...

Еще в разделе: (Показать все результаты (>147) - www.fadr.msu.ru/ )

• Untitled
• SPECIAL ISSUE OF CATENA «RECONSTRUCTION AND CLIMATIC IMPLICATIONS OF PALEOSOLS»
• Herbicide sensitivity of different species

... RPM gives you the tools you need to build a package on different types of computers. ... Before we get into RPM's capabilities, let's do a quick review of what is involved in developing software for different types of computer systems. ... The system software running on the computer. ... As far as package building is concerned, two systems with the same architecture running two different operating systems, are as different as two systems with different architectures running the same operating system...

Еще в разделе: (Показать все результаты (>339) - uneex.lorien.cs.msu.su/ )

• Apache IP-based Virtual Host Support - Apache HTTP Server
• Different Places an rpmrc File Resides
• alike. different.

Электронная библиотека Попечительского совета . ... Althaus E. - A branch-and-cut algorithm for multiple sequence alignment . ... Название: A branch-and-cut algorithm for multiple sequence alignment . Автор: Althaus E. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8887) - lib.mexmat.ru/ )

• Green J.A. - Sequences and series :: Электронная библиотека попечительского
• Lientz B.P., Larssen L. - Manage IT as a Business: How to Achieve Alignment and
• Lathrop R.H., Rogers Jr R.G., Smith T.F. - A Bayes-optimal sequence-structure

Next: A Universal Diagram for Up: ``Ecology'' of Magnetic Rotators Previous: The Corotation Radius . The interaction of a magnetic rotator with the surrounding plasma to a large extent depends on the relation between the four characteristic radii: the stopping radius, , the gravitational capture radius,   , the light cylinder radius,   , and the corotation radius,   . ... Hence, the classification of the interaction regimes may well mean the classification of magnetic rotators. ...

Еще в разделе: (Показать все результаты (>309) - xray.sai.msu.ru/ )

• E-P transitions for different orbits
• The COOC Criterion (Criterion of Observations versus Calculations)
• Main-sequence stars (stage I)

Biochemical analysis of the metabolism of small rodents living in different radioecological conditions . ... The initial differences of metabolism and their modification under the conditions of radioactive pollution of the environment are presented on the basis of the complex of biochemical parameters of two ecologically different species of small rodents ( Apodemus uralensis and Myodes rutilus ). ...

Еще в разделе: (Показать все результаты (>1180) - zmmu.msu.ru/ )

• Comparative skull morphology of two pika species (Ochotona princeps and O.
• Russian Journal of Theriology
• Epigenetic variation of the common shrew, Sorex araneus, in different habitats

... Different domain organization of two main conformational states of Na+/K+-ATPase]. ... The melting curves for the apoforms of Na+/K+-ATPases have different shapes: the curve for the enzyme from the rabbit shows one transition at 56.1 degrees C, whereas the denaturation of Na+/K+-ATPase from the duck is characterized by two transitions, at 49.8 and 56.9 degrees C. Sodium and potassium ions abolish the difference in the domain organization of Na+/K+-ATPases. ...

Еще в разделе: (Показать все результаты (>83) - biochem.bio.msu.ru/ )

• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein