markx0 # Report_file: ahpf_ecoli.matcher ######################################## #======================================= # # Aligned_sequences : 2 # 1: AHPF_ECOLI # 2: TRXB_BACSU # Matrix: EBLOSUM62 # Gap_penalty : 14 # Extend_penalty : 4 # # Length : 310 # Identity : 101/310 (32.6%) # Similarity: 170/310 (54.8%) # Gaps : 6/310 ( 1.9%) # Score: 455 # # #======================================= 210 220 230 240 250 ...

Еще в разделе: (Показать все результаты (>1179) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~ksenia_yashina/projects/aln/suboptimal.matcher
• http://kodomo.cmm.msu.ru/~seferyan_m/projects/emboss/risa_ecoli_risa_myctu.matcher
• http://kodomo.cmm.msu.ru/~bnagaev/Term2/alignment/alignment2/matcher.matcher

... PYRB_ECOLI 51 EASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYV 100 PYRB_VIBCH 101 DAFVMRHPQEGAARLASEFSNGVPVINAGDGSNQHPSQTLLDLYSIFETQ 150 || PYRB_ECOLI 101 DAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQ 150 PYRB_VIBCH 151 GRLDNLDVAFVGDLKYGRTVHSLAQALAKFDNNRFYFVAPEALAMPDYIC 200 || PYRB_ECOLI 151 GRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYIL 200 PYRB_VIBCH 201 EELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESEYAHIKSAYIL 250 :.| ...

Еще в разделе: (Показать все результаты (>72) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~smivic/Projects/1NZJ/downloads/aln.needle
• http://kodomo.fbb.msu.ru/~smivic/Projects/1NZJ/downloads/aln.water
• http://kodomo.fbb.msu.ru/~element/Term4/Block1/nucleot.txt

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>593) - lib.mexmat.ru/ )

• Zezula P., Amato G., Dohnal V. - Similarity Search: The Metric Space Approach
• Pisier G. - Similarity Problems and Completely Bounded Maps :: Электронная
• Pisier G. - The Kadison Similarity Problem :: Электронная библиотека

... UHECR SINP MSU . ... News . ... Publications . ... Multiple observations of Blue Jets (BJ)) show that BJ emits a fan of streamers similar to a laboratory leader. ... It was also noticed that BJ are similar to the streamer zone of a leader (streamer corona) and the modeling studies based on the streamers fractal structure were conducted. ... This similarity analysis has been done in three steps: First we described the dendritic structure of streamers in corona discharge applying the fractal theory. ...

Еще в разделе: (Показать все результаты (>5) - uhecr.sinp.msu.ru/ )

Hide Zen home . ... Tsearch2 . SAI RVO . SAI CAS . ... for "cosine similarity" only) . 1 days 3 days 7 days 14 days 21 days 28 days . List latest change per page only . List later changes tsearch2 ordinary changes . ... Title: . Title and Body: . ... SiteMap Changes HowTo 2016-04-11 2016-04-10 Blog . 0 Comments on cosine similarity This page is read-only View other revisions Administration . ... Zen, 2003-2007 ...

Еще в разделе: (Показать все результаты (>123) - www.sai.msu.su/ )

• Zen: ReadmeTrgm
• Zen: tp search en
• Full Text Search in databases

... Topic models: adding bigrams and taking account of the similarity between unigrams and bigrams" . Nokel M.A. and Loukachevitch N.V. The results of experimental study of adding bigrams and taking account of the similarity between them and unigrams are discussed. ... The proposed algorithm incorporates bigrams and takes into account the similarity between them and unigram components. Various word association measures are analyzed to integrate top-ranked bigrams into topic models. ...

Еще в разделе: (Показать все результаты (>5) - num-meth.srcc.msu.ru/ )

... A new method for synthesis of C60 polyfullerene in bulk quantities by irradiation of C60 water suspension is suggested. The properties of initial and photopolymerized dried suspension were studied by means of XRD, Raman and IR - spectroscopy and differential scanning calorimetry. Similarities and diversities of pressure-induced C60 polymer and C60 photopolymer are considered. ...

Еще в разделе: (Показать все результаты (>20) - chem.msu.ru/ )

• Similarity and difference of exciplexes with complete and partial electron

... Screening by Keyword then by Similarity . ... Protein banks . SWISSPROT protein databank TREMBL protein databank . ... Query Keyword string You can use here any keywords and 'or' , 'and' and 'andnot' logical operators. Query sequence (without name) . Examples of the Query Keywords: . proteinase cleave . DE [proteinase] AND cleave (could be written as: DE [proteinase] cleave) . DE [proline] DE [endopeptidase] ) OR ( KW [proteinase] DE [cleave] ) . XX[A$b5] ANDNOT cleave . ...

Еще в разделе: (Показать все результаты (>76) - www.genebee.msu.ru/ )

• Screening by similarity
• Notes on searching by similarity
• Bioinformatics portal, Moscow State University

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>4) - mouse.belozersky.msu.ru/ )

PHP Manual . Prev . Next . 3.0.7 - 3.0.18 only, PHP 4 >= 4.0.0) similar_text -- Calculate the similarity between two strings . int similar_text ( string first, string second [, float percent]) . This calculates the similarity between two strings as described in Oliver [1993]. ... By passing a reference as third argument, similar_text() will calculate the similarity in percent for you. It returns the number of matching chars in both strings. ...

Еще в разделе: (Показать все результаты (>8) - oit.cmc.msu.ru/ )

• Objects

... Distances between sequences . It is considered that the space, where all amino acids and sequences are analysed, is a metric one. ... When the distance between amino acids is entered, it is rather easy to consider such measure as pair distance between sequences in any position of alignment (in fact, this distance is just a distance between two amino acids). As distance is an additional quantity, pair distance between sequences on all alignment positions can be easily defined. ...

Еще в разделе: (Показать все результаты (>31) - monkey.belozersky.msu.ru/ )

• Internet Services
• S : Projects

... Department of Chemical Enzymology, School of Chemistry, Lomonosov Moscow State University, Moscow, 119899, Russia. ... The mapping of the fragments was done using a model structure of horseradish peroxidase. Five of six structurally similar fragments belong to the distal domain and form a subdomain in plant peroxidases that includes the distal heme-coordinating sequence, LHFHDC (amino acid residues 39-44 in horseradish peroxidase). ...

Еще в разделе: (Показать все результаты (>21) - www.enzyme.chem.msu.ru/ )

Atom subtypes present in protein structures: introducing dynamic atom similarity measure. ... St.Petersburg, 199034, Russia, gm2124@mail.ru Keywords: Atom subtypes, covalent bond lengths, protein structure. ... The cause of this issue is purely combinatorial, because if we treat each of the 20 aminoacids' heavy atoms as being of its own subtype, that leaves us with 167 different atom types, which in turn gives thousands of parameters to estimate even in a simple case of two atom interactions. ...

Еще в разделе: (Показать все результаты (>54) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/4.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/120.pdf

... Geometry optimization can be performed with analytical gradients at the HF, MP2, CI, DFT, TDHF, and TDDFT levels. ... The table below summarizes the current main capabilities of Firefly : Wavefunction RHF UHF ROHF GVB MCSCF Semiempirical SCF dm dm dm dm - SCF energy cdp cdp cdp cdp cdp SCF gradient cdp cdp cdp cdp cdp SCF Analytical Hessian cdp * - cdp * cdp * - DFT energy cdp cdp cdp - - DFT gradient cdp cdp ...

Еще в разделе: (Показать все результаты (>9) - classic.chem.msu.su/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... 2012 Spatial proximity and similarity of the epigenetic state of genome domains . Khrameeva EE , Mironov AA , Fedonin GG , Khaitovich P. , Gelfand MS . ...

Еще в разделе: (Показать все результаты (>89) - istina.msu.ru/ )

• Khaitovich P. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Ivkovich T.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Current Anthropology - журнал | ИСТИНА - Интеллектуальная Система Тематического

... To the Problem of Contact Symmetries Similarity for Ordinary Differential Equations . ... The result presented in work [2], allows to investigate the differential equations on the basis of analysis of solvable three-dimensional Lie algebra derived from two point symmetries and one contact symmetry. ... The carried out research allows to study the ordinary differential equations on the basis of two-dimensional Lie algebra derived from one point symmetry and one contact symmetry. ...

Еще в разделе: (Показать все результаты (>6) - acs366.phys.msu.su/ )

• AUTHOR : Timoshin M

Google as a taxonomic engine Alexey Shipunov Background: tree cow mouse rat Background: Google Scholar · · · · · · · Extract phyla names Obtain numbers of joint hits Do some magic Calculate similarity Make clusters Same, with - ecology Same, with classes names Numbers of joint hits · · · · · Phyla names from my synat classification R script to ...

Еще в разделе: (Показать все результаты (>35) - herba.msu.ru/ )

... Introduction to the contemporary phylogenetics ( a cladogenetic aspect). ... The book contains a review of theoretical fundamentals, principles, notions, methods, and applications of the contemporary phylogenetics (with emphasis on its cladogenetic aspect). ... Principal algorithms and methods of numerical phyletics are briefly outlined, including numerical estimates of phylogenetic relationship and recent methods of constructing phylogenetic trees (compatibility, parsimony, maximum likelihood , etc...

Еще в разделе: (Показать все результаты (>298) - zmmu.msu.ru/ )

• First record of Harpiola (Chiroptera, Vespertilionidae) from Vietnam
• Early Pleistocene mammalian fauna of Sarkel (Lower Don River area, Russia):
• Late Miocene Indarctos punjabiensis atticus (Carnivora, Ursidae) in Ukraine

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>2) - vestnik.math.msu.su/ )