AALD01000001_1 [5 - 877] AALD01000001.1 Yersinia mollaretii ATCC 43969 1008, whole genome shotgun sequence. ... MAYLSKSPQGPAPHSYYWLLTTDKHGCKNCCNHHQRSAKPLYWVRVCPHYGRPEFDRQKP RCSGYPSTTPVAHLMHCFLPINNVGRLNHLQHHDKQ >AALD01000001_8 [5427 - 5185] (REVERSE SENSE) AALD01000001.1 Yersinia mollaretii ATCC 43969 1008, whole genome shotgun sequence. ...

Еще в разделе: (Показать все результаты (>5472) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~desislava/Term3/Block2/credit/fragment1.orf
• http://kodomo.cmm.msu.ru/~nihilenia/term3/BLAST/orf_count.txt
• http://kodomo.cmm.msu.ru/~manyashka/Term3/Images/aald01000001.orf

... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...

Еще в разделе: (Показать все результаты (>627) - itpm.msu.su/ )

• Reverse Lookups
• Dokumentation zum Apache HTTP Server Version 2.0 - Apache HTTP Server
• sendsys, version, and senduuname

. Russian version . About the Center . Publications . Workshops . Databases (in Russian) . Send Your remarks by email

Еще в разделе: (Показать все результаты (>411) - hist.msu.ru/ )

• Web-ресурсы по экономической истории

. [ Войти ] . Главная -> Фильмы -> Reverse of the Curse of the .. Пользователи . Демо . Деньги . Фильмы . Форум . Reverse of the Curse of the Bambino . США 2004 . отметить . Документальный . Спорт .

Еще в разделе: (Показать все результаты (>829) - kinfo.ru/ )

• Pok?mon Ruby Version - Фильмы - Kinfo.ru
• Pok?mon: LeafGreen Version - Фильмы - Kinfo.ru
• Pok?mon: FireRed Version - Фильмы - Kinfo.ru

Welcome to K -corrections calculator, simple service allowing one to determine K -corrections of a galaxy, given its redshift and one or more colours. ... Please note that galaxy redshift should stay in the range between 0.0 and 0.5. ... K -correction in choose filter.. AB mag --- SDSS u SDSS g SDSS r SDSS i SDSS z UKIDSS Y UKIDSS J UKIDSS H UKIDSS K --- Vega mag --- Johnson U Johnson B Johnson V Cousins Rc Cousins Ic 2MASS J 2MASS H 2MASS Ks . Redshift . Colour choose colour.. ...

Еще в разделе: (Показать все результаты (>7) - kcor.sai.msu.ru/ )

The Fastdiag dynamic library (fastdiag.dll of Windows PC GAMESS/Firefly distributions, fastdiag.ex of Linux distributions) contains fast optimized modern algorithms of symmetric matrix diagonalization and inversion and is intended to improve the performance of initial guess generation, DIIS extrapolation, as well as some other computationally-intensive steps. ... However, DC-based code requires large amount of extra memory. ... It is usually as fast as kdiag=-1 but requires as much memory as kdiag=0. ...

Еще в разделе: (Показать все результаты (>90) - classic.chem.msu.su/ )

• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• PC GAMESS version 7.1 to version 7.1.5 update information
• Firefly v. 8.0.0 documentation - XP parallel modes of execution

download:main ]] . CompHEP . ... Latest versions . ... This Licence entitles the Licensee (one person) and the Licensee's research group to obtain a copy of the source or executable code of CompHEP and/or interfaces of CompHEP to other Monte-Carlo generators and to use the acquired program for academic research or other non-profit purposes within a research ... Source codes of CompHEP, v4.5.2 (release candidate 12) . ... Source codes of CompHEP, v4.4.93 (preliminary test version of 4.5.0) . ...

Еще в разделе: (Показать все результаты (>23) - comphep.sinp.msu.ru/ )

• news [CompHEP]
• install [CompHEP]
• download:rn-061106 [CompHEP]

. To see which versions of each file are current use the command: sccs what filename(s) .

Еще в разделе: (Показать все результаты (>127) - comet.sai.msu.ru/ )

• Check out an early version of a file
• Collection of Net References - Frame version
• UNIXhelp Version 1.3

... The basic core of the COMAGMAT-5.2 (2013) program includes the algorithm that has been used in previous versions of the COMAGMAT model (ver. 3.0-3.5) designed to simulate mafic magma crystallization processes . ... Ariskin A.A., Bychkov K.A., Danyushevsky L.V., McNeill A.W., Barmina G.S., Nikolaev G.S. (2012) COMAGMAT-5: a new magma crystallization model designed to simulate mafic to ultramafic sulfide-saturated systems. ... Contact ariskin@geokhi.ru . ... Ariskin A.A., Barmina G.S., Frenkel M.Ya., ...

Еще в разделе: (Показать все результаты (>4031) - geo.web.ru/ )

• Untitled Document
• Pavel Yu. Pletchov

... Dear site visitors, We are happy to present you english version of the site of the Department of Biochemistry! . ... Graduates of 2011 year . Graduates of 2012 year . Graduates of 2013 year . ... Graduates of 2010 year . Graduates of 2009 year . Graduates of 2008 year . Graduates of 2007 year . Graduates of 2006 year . Graduates of 2005 year . Graduates of 2004 year . Graduates of 2003 year . Graduates of 2002 year . Graduates of 2001 year . ...

Еще в разделе: (Показать все результаты (>99) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | About us
• Reversibility of nucleoside diphosphate kinase solubilization from the surface

Schools of Philology, Psychology, and of the Arts, Moscow State University held 1-3 October, 2010 an international conference entitled . FREE VERSE AND FREE DANCE: EMBODIED SENSE IN MOTION . ... In addition to paper sessions and thematic round-table discussions, the conference included master classes in free dance & musical movement training, sessions of vers libres, sound poetry, dance and contact improvisation, and site-specific performances. All master classes were open for participants. ...

Еще в разделе: (Показать все результаты (>7) - discours.philol.msu.ru/ )

... 333/2 including HTML versions of articles . ... 332/3 including HTML versions of articles . ... 331/3 including HTML versions of articles . ... 330/3 including HTML versions of articles . ... December 1997 . ... November 1997 . ... Indexed/abstracted in Astronomy and Astrophysics Abstracts, CAS, Current Contents, INIS, Inspec, Physics Abstracts, Physics Briefs, PHYS on STN, Science Citation Index, Technical Information Center/Energinfo, and Zentralblatt f r Mathematik . ... helpdesk@link.springer.de...

Еще в разделе: (Показать все результаты (>5891) - crydee.sai.msu.ru/ )

• Fortran 90 texts and links

... RenderListPlugin 7 - 2004-03-21 - PeterThoeny . ... Plugin Version: . ... attr="h" comment="Empty 16x16 spacer" date="1070519327" name="empty.gif" path="C:\Data\MyTWiki\Plugins\RenderListPlugin\pub\TWiki\RenderListPlugin\empty.gif" size="100" user="PeterThoeny" version="1.1" . ... attr="h" comment="Dot T-graph 16x16" date="1070519374" name="dot_udr.gif" path="C:\Data\MyTWiki\Plugins\RenderListPlugin\pub\TWiki\RenderListPlugin\dot_udr.gif" size="109" user="PeterThoeny" version="1.1" . ...

Еще в разделе: (Показать все результаты (>37901) - dualopt1.cmm.msu.ru/ )

• TWikiMetaData - TWiki - TWiki
• TWikiMetaData - TWiki - TWiki - (printable)

Support ] [ Links to DC resistivity and IP software in WWW ] . ... TRF_2D for Windows - Automated 2D Inversion Program for VES Travers Data. ... The scientists of the laboratory are developing algorithms and computer programs for decision of forward and inverse problems of resistivity and induced polarization methods, which are widely known in Russia and are applied in many countries abroad. ... IE2DL - the set of the programs for resistivity and IP data modeling in 2D inhomogeneous media . ...

Еще в разделе: (Показать все результаты (>52) - geophys.geol.msu.ru/ )

• Theory of resistivity sounding
• IPI2win - 1D interpretation of VES profile.
• Links of engineering geophysics and software

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>129) - higeom.math.msu.su/ )

The biofouling problems in reverse osmosis and ultrafiltration elements are considered. ... Based on obtained data the prognosis for point-of-use reverse osmosis element applied on tap water was done. ... Keywords: reverse osmosis, ultrafiltration, biofouling, biofilm, prediction of product flow decrease, removal of foulants. ... Flemming H.-C. Reverse Osmosis Membrane Biofouling. ... Flemming H. C., Schaule G., Investigation on biofouling of reverse osmosis and ultrafiltration membranes. ...

Еще в разделе: (Показать все результаты (>588) - chem.msu.ru/ )

• Построение 3D изображения поверхности блок-сополимера стирол-бутадиен-стирола
• Moscow University Chemistry Bulletin Vol. 43, No. 1, P. 20 (2002)
• Moscow University Chemistry Bulletin Vol. 51, No. 2, P. 102 (2010)

Shipunov A.B. Systema Angiospermarum [Electronic resource]. 1991 onwards. ... Current version: . Classification , PDF (version information inside) . ... Version 5.1 , PDF, used in: Shipunov A., Reveal J.L. Validation of subordinal names for "Systema Angiospermarum" // Phytotaxa. ... Version 4.977 , PDF, used in: Reveal J.L. Summary of recent systems of angiosperm classification // Kew Bulletin. ... The system is traditional: it means that paraphyletic taxa are widely (but not elsewhere) accepted. ...

Еще в разделе: (Показать все результаты (>386) - herba.msu.ru/ )

• Systema Naturae
• Bulletin of Moscow Society of Naturalists. Biological series.
• BIOL 111: Concepts of Biology

МГУ имени М.В.Ломоносова English version . ... 11 апреля . Международная научная конференция студентов, аспирантов и молодых ученых ?Ломоносов-2016? . ... Универсиада ?Ломоносов? по почвоведению и экологии . ... Международная научная конференция школьников ?XVI Колмогоровские чтения? . ... Ближайшие конференции . 01 декабря . Универсиада ?Ломоносов? по прикладной математике и информатике . ... МГУ имени М.В. Ломоносова . ... 119991, г.Москва, Ленинские горы, д.1, Главное здание МГУ . ...

Еще в разделе: (Показать все результаты (>1857) - conf.msu.ru/ )

• Ibrohimkhuja Idrisovich Saidov / МГУ имени М.В.Ломоносова
• Frosina Angeleski Angeleska / МГУ имени М.В.Ломоносова
• Eliasz Noname / МГУ имени М.В.Ломоносова

. Moscow State University Belozersky Institute of Physico-Chemical Biology . English version Russian version . Web-design by Sergei Golyshev .

Еще в разделе: (Показать все результаты (>3) - cellbiol.genebee.msu.ru/ )