... pair_cores/web/approot/locales/pair-cores-web.xml pair_cores/web/approot/locales/pair-cores-web_ru.xml pair_cores/web/pair-cores.cpp . ... 2.1 --- a/ pair_cores / web / approot / locales /pair-cores- web _ru.xml Fri Jan 11 18:28:45 2013 + 0400 2.2 +++ b/ pair_cores / web / approot / locales /pair-cores- web _ru.xml Fri Jan 11 19:58:32 2013 + 0400 2.3 @@ -28,6 +28,57 @@ 2.4 2.5 message id='pair.main.Refresh' Обновить / message 2.6 message id='pair.main.Reset' Сбросить / message 2.7 + ...

Еще в разделе: (Показать все результаты (>112817) - kodomo.fbb.msu.ru/ )

• allpy: b75dc5174a7f
• allpy: 3ed2dc81ac73
• allpy: 45573ee48844

... help . find changesets by author, revision, files, or words in the commit message hg update [-c] [-C] [-d DATE] [[-r] REV] aliases: up, checkout, co update working directory (or switch revisions) Update the repository's working directory to the specified changeset. ... With the -c/--check option, the working directory is checked for uncommitted changes; if none are found, the working directory is updated to the specified changeset. ... See "hg help dates" for a list of formats valid for -d/--date. ...

Еще в разделе: (Показать все результаты (>3981) - kodomo.cmm.msu.ru/ )

• Help: bookmarks
• petri_dish: bookmarks
• Help: phases

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6978) - mouse.belozersky.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>238) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SDPpred
• About this project

Электронная библиотека Попечительского совета . ... Althaus E. - A branch-and-cut algorithm for multiple sequence alignment . ... Название: A branch-and-cut algorithm for multiple sequence alignment . Автор: Althaus E. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>3891) - lib.mexmat.ru/ )

• Поиск книг, содержащих Bookmark :: Электронная библиотека попечительского
• Поиск книг, содержащих Опция, bookmarks :: Электронная библиотека
• Haase W., Selmin V., Winzell B. (eds.) - Bookmark and Share Progress In

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• Algorithm
• SDPlight

... HELP ON SCREENING OF PATTERN OR ALIGNMENT AGAINST PROTEIN PROTEIN . ... The method of looking for all pattern entries (possibly inexact) in PROTEIN databank is almost the same as in PROSITE screening procedure. ... The screening by query alignment, based on the same principle: the alignment is seen as a pattern defining letter's frequencies in every position. The pattern example: . ... the only one capital letter at a position means that only given residue should be at the position. ...

Еще в разделе: (Показать все результаты (>105) - www.genebee.msu.ru/ )

• GeneBee
• OUTPUT
• IGLA-3D User Guide

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>25) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>589) - www.sai.msu.su/ )

• Finding Out About (FOA) Bookmarks
• Oleg Bartunov's Home Page
• Jenam 2000

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>122) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/245.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/197.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/120.pdf

. PHP Manual . Prev . Next . (PHP 4 ) pdf_add_bookmark -- Adds bookmark for current page . int pdf_add_bookmark ( int pdf object, string text [, int parent [, int open]]) . Add a nested bookmark under parent , or a new top-level bookmark if parent = 0. Returns a bookmark descriptor which may be used as parent for subsequent nested bookmarks. If open = 1, child bookmarks will be folded out, and invisible if open = 0. Prev . Home . Next . pdf_add_annotation . Up . pdf_add_launchlink

Еще в разделе: (Показать все результаты (>87) - oit.cmc.msu.ru/ )

• cpdf_add_outline

... Astro-ph E-print archive . THE NASA ASTROPHYSICS DATA SYSTEM . ... Tables of contents . ... Multimission Archive at STScI . Local archive of IAUC IRCULARS . ... Astrophysical Constants (PDF) . ... Starcast search in astronomy archives . ... Cambridge University Press Handbook of Space Astronomy and Astrophysics . ... Astronomy Astrophysics . Astronomy Astrophysics Supplement Series . Astrophysical Journal . Astrophysical Journal Supplement Series . ... Galka Homepage ...

Еще в разделе: (Показать все результаты (>46) - xray.sai.msu.ru/ )

• Bookmarks for Sergei Popov
• Sergei Popov's Bookmarks
• N.Shakura's Bookmarks

... NASA ADS . ... Astronet . ... Sergei Popov's Bookmarks . ... Russian Academy of Sciences . SETI-site of the Stenberg Astronomical Institute . ... Shvartsman V.F. Gurevich I.M. Panov A.D. Movie Database . ... Subtitles 1 . ... Writers Guild of America . ... Ancient Rome . ...

Еще в разделе: (Показать все результаты (>58) - lnfm1.sai.msu.ru/ )

• Bookmarks for Andrew I. Zakharov
• Bookmark

. GMAIL .

Еще в разделе: (Показать все результаты (>5) - astrometric.sai.msu.ru/ )

... Finance - Currency Conversion . FXConverter - OANDA's 164 Currency Converter . ... PNAS Online -- Search Multiple Journals . ... Scirus - For Scientific Information Only . Molecular Biology Software . Education and Genetics: Human Genome Project Information . Journal of Computational Biology Table of Contents . LINK Alert Service - Subscribe . Springer LINK - Forum for Science . ... Genome Biol Vol. ... COMPUTATIONAL BIOLOGY . ... Journal Impact Factor 2000 . ...

Еще в разделе: (Показать все результаты (>13) - higeom.math.msu.su/ )

Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit eutils flag-o-matic multilib toolchain-funcs EXTENSIONS = -without- extensions DESCRIPTION= Multiple sequence alignments using a variety of algorithms HOMEPAGE= http:// mafft .cbrc.jp/alignment/software/index.html SRC_URI= http:// mafft .cbrc.jp/alignment/software/${P}${ ...

Еще в разделе: (Показать все результаты (>8118) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/mafft/mafft-7.050.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/clustalw-mpi/clustalw-mpi-0.13-r1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-chemistry/mustang/mustang-3.2.1.ebuild

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>17) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... CommentPluginTemplate 4 - 2006-12-16 - Main.TWikiContributor . Line: 1 to 1 . ... Line: 261 to 261 . ... Talk using TOC adding on end - TWiki:Main/FranzJosefSilli . Create a list of annotated bookmarks - TWiki:Main/FranzJosefSilli . ... Revision 4 . ... Copyright by the contributing authors. ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.CommentPluginTemplate . ...

Еще в разделе: (Показать все результаты (>25969) - dualopt1.cmm.msu.ru/ )

• CommentPluginTemplate - TWiki - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• CommentPluginTemplate - TWiki - TWiki - (printable)

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>356) - num-meth.srcc.msu.ru/ )

• Contents.Volume 1
• "Pointwise extra-optimal regularizing algorithms"
• A multilevel approach to algorithm and software design for exaflops