... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 44 def set_map_in ( self , map_in ): . ... 54 def __getitem__ ( self , item ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out ) . ... 103 def items ( self ): . ...

Еще в разделе: (Показать все результаты (>44779) - kodomo.fbb.msu.ru/ )

• allpy: d9a3e99ae19b allpy/markup.py
• allpy: f3358da68bcd allpy/markup.py
• allpy: a3df15a42f9d allpy/markup.py

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>33) - mouse.genebee.msu.ru/ )

This module is contained in the mod_setenvif.c file, and is compiled in by default. It provides for the ability to set environment variables based upon attributes of the request. The mod_setenvif module allows you to set environment variables according to whether different aspects of the request match regular expressions you specify. ... Module: mod_setenvif . Compatibility: Apache 1.2 and above (in Apache 1.2 this directive was found in the now-obsolete mod_browser module) . ...

Еще в разделе: (Показать все результаты (>660) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_auth_dbm
• Apache module mod_auth
• Apache module mod_auth_db

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>264) - comet.sai.msu.ru/ )

• HTML Math
• Divisions
• The IMG (Image) Element

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>200) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• OUTPUT
• Fasta3 help

Homepage: http://foswiki.org/Extensions/JQueryPlugin . ... Shrinks all urls in a given container whose link text exceeds a given size and have no white spaces in it, that is don't wrap around nicely. ... JQREQUIRE{"shrinkurls"}% <div class="jqShrinkUrls" data-size="25" data-whitespace="true"> <a href="#">Lorem ipsum dolor sit amet, consectetur adipiscing elit. ... Lorem ipsum dolor sit amet, consectetur adipiscing elit. ... This topic: System > JQueryPlugin > JQueryShrinkUrls . ...

Еще в разделе: (Показать все результаты (>7289) - wiki.cmc.msu.ru/ )

• VarTABLE < System < Foswiki

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10620) - lib.mexmat.ru/ )

• Cardoza P. - Absolute Beginner's Guide to Microsoft Office OneNote 2003 ::

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:25:05 . 2.4K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 0.8K . application/octet-stream . Manifest . 2016-Jan-25 18:25:05 . 1.8K . application/octet-stream . data-default-instances-containers-0.0.1.ebuild . 2015-Aug-09 03:38:18 . 0.6K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.3K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>24024) - mirror.msu.net/ )

IMPALA: Integrating Matrix Profiles And Local Alignments 1. ... Primary preprocessing Prepare the following files : i. a collection of PSI-BLAST-generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>7882) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/bl2seq.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/fastacmd.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/blastclust.html

Лаборатория концентрирования, общая информация . ... общих вопросов аналитической химии (история, терминология, география, кадры, популяризация и др.; академик Ю.А. Золотов); . сорбционного концентрирования элементов, органических соединений и поиска новых сорбентов (группы д.х.н. Г.И. Цизина, д.х.н. С.Г. Дмитриенко, д.х.н. Е.И. Моросановой); . разработки экспрессных тест-методов химического анализа, главным образом вне лаборатории (группы д.х.н. Е.И. Моросановой, д.х.н С.Г. Дмитриенко); . ...

Еще в разделе: (Показать все результаты (>32) - analyt.chem.msu.ru/ )

Each Apache configuration directive is described using a common format that looks like this: . Syntax: directive-name some args . ... Context: context-list . ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ... A directive marked as being valid in this context may be used inside <Directory> containers in the server configuration files.htaccess . ...

Еще в разделе: (Показать все результаты (>918) - oit.cmc.msu.ru/ )

• xml_set_default_handler
• Pattern Modifiers
• OCIFetchInto

... Distances between sequences . It is considered that the space, where all amino acids and sequences are analysed, is a metric one. ... When the distance between amino acids is entered, it is rather easy to consider such measure as pair distance between sequences in any position of alignment (in fact, this distance is just a distance between two amino acids). As distance is an additional quantity, pair distance between sequences on all alignment positions can be easily defined. ...

Еще в разделе: (Показать все результаты (>1836) - monkey.belozersky.msu.ru/ )

• About this project
• SDP home page
• SDPpred

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPpred
• User's guide

... TWikiAttrsDotPm . Class of attribute sets, designed for parsing and storing attribute values from a TWiki tag e.g. %TAG{"joe" fred="bad" joe="mad"}% . ... The default parameter (unnamed quoted string) is named _DEFAULT in the hash. ... As well as the default TWiki syntax (parameter values double-quoted) this class also parses single-quoted values, unquoted spaceless values, spaces around the =, and commas as well as spaces separating values. ... remove ObjectMethod remove ($key) -> $value . ...

Еще в разделе: (Показать все результаты (>41420) - dualopt1.cmm.msu.ru/ )

• TWikiAttrsDotPm - TWiki - TWiki - (printable)
• %TOPICTITLE% (15 vs. 16) - TWiki
• WebSearchAdvanced - _default - TWiki

... MAXLEN parameter specifies maximum length of the number considered as a 'good' integer. ... If REJECTLONG = FALSE (default), than dictionary returns prefixed part of integer number with length MAXLEN . ... This is a dict_tmpl.c file. # include postgres.h # include utils/builtins.h # include fmgr.h #ifdef PG_MODULE_MAGIC PG_MODULE_MAGIC; #endif # include utils/ts_locale.h # include utils/ts_public.h # include utils/ts_utils.h typedef struct { int maxlen ; bool rejectlong ; } ...

Еще в разделе: (Показать все результаты (>2518) - www.sai.msu.su/ )

• Zen: CASDB
• FTS Complete Tutorial
• Open Source Convention

... Foswiki::Search::InfoCache - Support package; cache of topic info. ... ObjectMethod finish() . ObjectMethod metacache . ... If _callback is set, that means the caller wants results as soon as they are ready. =_callback_ should be set to a reference to a function which takes _cbdata as the first parameter and remaining parameters the same as 'print'. ... Note: If format is set, template will be ignored. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>2377) - wiki.cs.msu.ru/ )

• VarTWISTY < System < Foswiki
• WebRssBase < System < Foswiki
• VarBUTTON < System < Foswiki

... ONLY include the controls you are actually using. ... only used if > -100 !Profile_xmax = 1.2 !-101 ! ... only used if > -100 Profile_other_ymax = -101 ! ... step number. negative means use default. ... negative means use same value as for window CONV_file_aspect_ratio = -1 ! negative means use same value as for window ! ... negative means use same value as for window Surf_Hist_file_aspect_ratio = -1 ! ... negative means use same value as for window Power_file_aspect_ratio = -1 ! ...

Еще в разделе: (Показать все результаты (>2014) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M8_Z002/inlist_project
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M6_Z002/inlist_project
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M7_Z002/inlist_project

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>364) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/spectrum1d.html
• http://xray.sai.msu.ru/~ivan/gmt/man/filter1d.html
• http://xray.sai.msu.ru/~ivan/gmt/man/xyz2grd.html

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>637) - uneex.lorien.cs.msu.su/ )

• Terms Used to Describe Directives - Apache HTTP Server
• The prefix tag: Relocation Central
• mod_dav - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>509) - itpm.msu.su/ )

• send, wait and sleep
• Terms Used to Describe Directives - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - Concept Index