... allpy.base: Added decency verification function to alignments (closes #98) Currently, the verification function asserts that no two sequences in an alignment have the same identifier. author . ... 3 This release collects a lot of changes that happened during half year . ... 8 * greatly improved markups support and markups IO . ... 12 * and a lot of work on ` blocks3d ` and ` pair_cores ` with many new features , . ... 69 * new : File format 'markup' for storing alignment with arbitrary markups . ...

Еще в разделе: (Показать все результаты (>97879) - kodomo.fbb.msu.ru/ )

• allpy: .hgignore annotate
• allpy: debian/rules annotate

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6980) - mouse.belozersky.msu.ru/ )

Home page . ... GeneBee . ... A4 - Genebee Adaptive Automated Annotation . ... Home . Advanced query . Annotation title . ... ITA[1,1] ITA[0,1] USUAL . Additional output . ... NRAS_1 MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET CLLDILDTAG QEEYSAMRDQ VFAINNSKSF ADINLYREQI KRVKDSDDVP MVLVGNKCDL PTRTVDTKQA HELAKSYGIP GVEDAFYTLV REIRQYRMKK LNSSDDGTQG CMGLPCVVM . ... Last updated: December 23, 2008. ...

Еще в разделе: (Показать все результаты (>117) - www.genebee.msu.ru/ )

• Genebee Predicted Annotation - Advanced
• GeneBee

... annotate . ... ksenia_yashina@8 . ... 6 def __init__ ( self , delay = 10 , diam = 300 , num = 1 , env = 1 , reprod_a = False , reprod_s = False , life = 1 ): . ... 7 self . ... 15 def __repr__ ( self ): . ... 16 return "< %s , %s , %s , %s , %s , %s , %s >" % ( self . delay , self . diam , self . ... config ( text = "Stop" , command = self . ... config ( height = self . ... grid ( row = 0 , column = 2 , rowspan = 6 , padx = 50 , pady = 10 ) . ... config ( text = "Submit" , command = self . ...

Еще в разделе: (Показать все результаты (>3580) - kodomo.cmm.msu.ru/ )

• petri_dish: Bacteria.py annotate
• petri_dish: Petri.py annotate
• petri_dish: tk1.py annotate

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>267) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• SDP home page
• Inquiry information || Formats of alignments

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

... Next . 3.0.12 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_add_annotation -- Adds annotation . void cpdf_add_annotation ( int pdf document, float llx, float lly, float urx, float ury, string title, string content [, int mode]) . The cpdf_add_annotation() adds a note with the lower left corner at ( llx , lly ) and the upper right corner at ( urx , ury ). The optional parameter mode determines the unit length. If it's 0 or omitted the default unit as specified for the page is used. ...

Еще в разделе: (Показать все результаты (>72) - oit.cmc.msu.ru/ )

• Java Distributed Computing course annotation
• pdf_add_annotation
• pdf_add_launchlink

Astronomy Picture of the Day . ... 11.11.1997 . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... November 1997 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: Galactic Center . Publications with words: Galactic Center . ... Sgr A*: Fast Stars Near the Galactic Center . ...

Еще в разделе: (Показать все результаты (>3604) - www.astronet.ru/ )

• Астронет > An Annotated Leonid
• Астронет > The Annotated Galactic Center

RnaViz . RnaViz is a user-friendly, portable, windows-type program for producing publication-quality secondary structure drawings of RNA molecules. Drawings can be created starting from DCSE alignment files if they incorporate structure information or from mfold ct files. The layout of a structure can be changed easily. ... Home Site: . http://rrna.uia.ac.be/rnaviz/ . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>319) - www.sai.msu.su/ )

• APOD: November 30, 1998 - An Annotated Leonid
• APOD: 2001 December 29 - The Annotated Galactic Center
• APOD: 2010 August 31 - The Annotated Galactic Center

An annotated checklist of the insectivores (Mammalia, Lipotyphla) of Vietnam . Abramov A.V., Dang Ngoc Can, Bui Tuan Hai Nguyen Truong Son . P. 57-70 . An annotated checklist of 32 extant species from 12 genera of the insectivores (Mammalia, Lipotyphla) of Vietnam is provided. ...

Еще в разделе: (Показать все результаты (>228) - zmmu.msu.ru/ )

• Russian Journal of Theriology

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1259) - lib.mexmat.ru/ )

• Friedman A., Klander L., Michaelis M. - C/C++ Annotated Archives :: Электронная
• Поиск книг, содержащих BibTeX'овский стиль, annotate :: Электронная библиотека
• Schilder F. (ed.), Katz G. (ed.), Pustejovsky J. (ed.) - Annotating, extracting

SCIENTIFIC TASKS AND RESULTS . In the results of searching for new perspective solid state materials for the quantum electronics, non-linear optics and other fields of physics more than 200 various oxide compounds were synthesized and peculiarities of their atomic structure and physical properties are studied. Single crystals of 80 such the compounds are grown and thoroughly investigated. ... A family of oxide-ion conductors on the base of La 2 Mo 2 O 9 (30.10.09) . ... Main page ...

Еще в разделе: (Показать все результаты (>51) - polly.phys.msu.ru/ )

... 2016, issue ? 1 : Annotation . ... 1 : Contents . 2015, issue ? ... 2014, issue ? ... 2013, issue ? ... 2012, issue ? ... 2011, issue ? ... 2010, issue ? ... 2009, issue ? ... 2008, issue ? ... Web-site of Russian Journal of Biological Invasions is developed and supported by the . Group of Bioinformatics and Modeling Biological Processes" IPEE RAS . ... Russian Journal of Biological Invasions . ...

Еще в разделе: (Показать все результаты (>314) - www.sevin.ru/ )

• Russian journal of biological invasions: Contents
• Russian Journal of Biological Invasions: 2012, issue ? 2
• Russian Journal of Biological Invasions: 2013, issue ? 3

... Second, alignment of highly similar genomic sequences is useful for comparison of genome assemblies of the same organism or closely related ones. ... Nucleotide pangenome (NPG) of an input set of genomes is a set of aligned blocks, each block composed of orthologous fragments. ... Hemi-stable blocks (h-blocks) include no more than one fragment of a genome and lack a fragment of at least one of genomes. ... Blocks with repeats (r-blocks) include more than one fragment from one or several genomes. ...

Еще в разделе: (Показать все результаты (>128) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/42.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>6) - www.arcetri.astro.it/ )

... 2016-Jan-25 18:28:47 . ... application/octet-stream . ... 0.6K . text/plain . ... text/xml . ...

Еще в разделе: (Показать все результаты (>4893) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-java/jackson-module-jaxb-annotations/
• Index of /pub/gentoo-portage/dev-perl/Algorithm-Annotate/
• Index of /pub/gentoo-portage/dev-java/myfaces-builder-annotations/

Faculty of Soil Science, Moscow State University, Moscow 119899, Russia . ... Response of soil and soil water of podzols in the Kola Peninsula to acid deposition was estimated under both field and laboratory conditions. A significant increasing trend of exchangeable acidity in organic (O) horizons and exchangeable Al in podzolic (E) horizons of podzols with distance from the nickel smelter was observed. ... Simulated acid rain enhanced the leaching of exchangeable base cations out of root zone. ...

Еще в разделе: (Показать все результаты (>32) - eco.soil.msu.ru/ )

• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• CRITICAL LOADS OF ACID DEPOSITION FOR FORESTS
• SIMULATION OF ACID SNOW AND RAIN IMPACT ON FORESTS

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• SDPlight
• Alignment example
• SDPpred

I would like to propose two new features for the axes annotation in the GMT. 1st: In astrophysics, we often work with great ranges of values (many orders of magnitude). ... However, GMT 3.2 allows to plot annotations for log10 axes every integer log10 value or even more frequently. The proposed patch allows to specify large steps for the log10 axes, in the form illustrated by an example below. 2nd: 10^0 instead of 1, and 10^1 instead of simply 10 do not look beautiful. ... The patch is here. ...

Еще в разделе: (Показать все результаты (>152) - xray.sai.msu.ru/ )

• Seminars
• Talk at ASA