... Project.alignment --> Project.body . ... Absolutely not understandable. 2.46 @@ -70,9 +70,9 @@ 2.47 all_columns = [] 2.48 for position in range( len ( self )): 2.49 column_percentage = {} 2.50 - for seq in self.alignment : 2.51 - if self.alignment [ seq ][ position ] is not None: 2.52 - aa = self.alignment [ seq ][ position ].code 2.53 + for seq in self.body : 2.54 + if self.body [ seq ][ position ] is not None: 2.55 + aa = self.body [ seq ][ ...

Еще в разделе: (Показать все результаты (>51250) - kodomo.fbb.msu.ru/ )

• allpy: 38888b46c342
• allpy: fb3164f03984 lib/block.py
• allpy: b2ec17578145 lib/block.py

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>175) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Screening by similarity
• RNA secondary structure prediction

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• RNA Alignment
• SDPpred

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6992) - mouse.belozersky.msu.ru/ )

• Blocks finder

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1493) - monkey.belozersky.msu.ru/ )

• About this project
• Example of supporting positions
• Inquiry information || Distances

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

... High-scoring Sequences . ... The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database. ... Sequence Name . ... Following the description line(s) is a line giving the length, combined p-value, and E-value of the sequence as defined in Section I. The next line reproduces the motif diagram from Section II. ...

Еще в разделе: (Показать все результаты (>4811) - kodomo.cmm.msu.ru/ )

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>261) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/66.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/149.pdf

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1653) - crydee.sai.msu.ru/ )

• Long description illustrating absolute positioning with respect to the initial
• Long description for example illustrating positioning with respect to a
• Property index

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>1610) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - SC_rate
• SAL- Other Scientific Fields - Chemistry, Biology Related - ClustalW
• SAL- Other Scientific Fields - Chemistry, Biology Related - GRS

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>204) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmean.html

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... This page is a reference for all CSS classes used in PatternSkin . ... All templates that are not the view template have the body class name "patternNoViewPage". ... patternTopBar - top bar area .patternTopBarContents - table (for easy vertical alignment) for header art / logo; contains topic WebTopBar . ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.PatternSkinCss . ...

Еще в разделе: (Показать все результаты (>32589) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (2 vs. 3) - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• PatternSkinCss - TWiki - TWiki - (printable)

Электронная библиотека Попечительского совета . ... Pawson D. - XSL-FO . ... Author Dave Pawson is well known in the XSLT and XSL-FO communities, and maintains the XSLT FAQ. ... instream-foreign-object> element . ... absolute-position property . ... fo:region-after element, region-name property for . ... fo:region-before element, region-name property for . ... fo:region-body element, region-name property for . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>5278) - lib.mexmat.ru/ )

• Sachkov V.N., Tarakanov V.E. - Combinatorics of Nonnegative Matrices ::
• Althaus E. - A branch-and-cut algorithm for multiple sequence alignment ::
• Moeller T.B. - Magnetic Resonance Imaging, Parameters and Positioning ::

... Clouds and the Moon Move to Block the Sun . ... Explanation: High above a small church near Vienna, Austria , clouds and the Moon vied for position in front of the Sun. Such was the case on the ground late last month during a partial eclipse of the Sun visible throughout Europe and Asia . Nearing the farthest part of its orbit around the Earth , the Moon's angular size was too small to block the entire Sun, a situation that would have resulted in a total solar eclipse . ...

Еще в разделе: (Показать все результаты (>6370) - www.astronet.ru/ )

• Астронет > Clouds and the Moon Move to Block the Sun
• Waterton Lake Eclipse
• Journal "Peremennye Zvezdy"

Mustela . On a taxonomic position of the weasel (Carnivora, Mustela ) from the Cheju Island (South Korea) . ... The weasel from Cheju Island (formerly в?' Quelpart Island), which is situated in Korean Strait south of the coast of South Korea, was described as a separate species Lutreola quelpartis Thomas, 1908. ... Abramov A.V. 2000b. The taxonomic status of the Japanese weasel, Mustela itatsi (Carnivora, Mustelidae) // Zoologicheskii Zhurnal. ... A Pictorial Guide to the Mammals of Japan. ...

Еще в разделе: (Показать все результаты (>859) - zmmu.msu.ru/ )

• Taxonomic position of Eptesicus bobrinskoi - abstract

. A block of text is referred to in MicroEMACS as a 'region'. It is defined by the position of a special 'mark' at one end, and by the cursor (referred to as the 'point') at the other. This section explains how you can: . Move a block of text . Copy a block of text . Delete a block of text . Did You Know? .

Еще в разделе: (Показать все результаты (>101) - comet.sai.msu.ru/ )

• Moving a block of text
• Rudnitskij Georgij M. Home Page

... Data Access Routines . ... There are three orthogonal aspects to data access: positioning (explicit offset vs. implicit file pointer), synchronism (blocking vs. nonblocking and split collective), and coordination (noncollective vs. collective). ... The split collective routines support a restricted form of ``nonblocking'' operations for collective data access (see Section Split Collective Data Access Routines ). ... Every noncollective data access routine MPI_FILE_XXX has a collective counterpart. ...

Еще в разделе: (Показать все результаты (>336) - www.parallel.ru/ )

• Index | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Derived datatypes | PARALLEL.RU - Информационно-аналитический центр по
• MPI_File_get_position | PARALLEL.RU - Информационно-аналитический центр по

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. Filter automatically determines the blockiness's strength on the frame and in the certain part of it, preserving the maximum of details. ...

Еще в разделе: (Показать все результаты (>166) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Лаборатория компьютерной графики и
• Smart removal of blocking effects from video | Graphics and Media Lab
• Smart removal of blocking effects from video | Лаборатория компьютерной графики

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: to become in a position to those people i . ... Sunglasses fashion designers nowadays absolutely are a position symbol, nonetheless, for being modern in sun shades, you are doing not need to compromise on high quality. ... Sun shades, ie to the seaside, are already a well-liked manner statement because the 1950's. The lens colour could differ with trend, purpose and elegance. ...

Еще в разделе: (Показать все результаты (>1952) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: for being in a position to the
• Экологический Форум - Фундаментальная Экология: I also trace their position
• Экологический Форум - Фундаментальная Экология: to be in a position to the

... Qt tutorial 5 ** ****************************************************************/ # include qapplication.h # include qpushbutton.h # include qscrollbar.h # include qlcdnumber.h # include qfont.h class MyWidget : public QWidget { public: MyWidget ( QWidget *parent=0, const char *name=0 ); protected: void resizeEvent( QResizeEvent * ); private: QPushButton * quit ; QScrollBar * sBar ; QLCDNumber * ... QScrollBar is a classical window system scroll bar. ...

Еще в разделе: (Показать все результаты (>398) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QGridLayout Class
• Qt Tutorial - Chapter 6
• Qt Toolkit - QPaintDevice Class