... Changed the way related types are stored for Alignment, Block, Sequence, Monomer Now each of them has attribute 'type', which is an object with four attributes: - Alignment - Block - Sequence - Monomer . ... allpy/base.py allpy/dna.py allpy/protein.py allpy/rna.py . ... allpy/base.py . ... allpy/dna.py . ... allpy/protein.py . ... allpy/rna.py . ... 1.59 - # Actually given value at EOF, since name Block is not yet defined 1.60 - 1.61 - sequence_type = Sequence 1.62 - """Type of sequences in...

Еще в разделе: (Показать все результаты (>103850) - kodomo.fbb.msu.ru/ )

• allpy: 4a2341bc90b1
• allpy: b6c1eaad5ac6
• allpy: 4d610c277281

... Length = 10596 Score = 115 bits (289), Expect = 8e-27 Identities = 126/429 (29%), Positives = 183/429 (42%), Gaps = 18/429 (4%) Frame = +3 Query : 12 VDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTALGVSY-TLSADR 70 + G++ +PG KSVS+RA++ AALA G + + L+ +D R LGV T SA + Sbjct : 6453 LQGSLTIPGDKSVSHRAVMFAALADGISKIDGFLEGEDTRSTAAIFAQLGVRIETPSASQ 6632 Query : 71 TRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPRMKERPIGHLV 130 +G G +G L+ GNAGT MR LA L D VL G+ + +RP+ + ...

Еще в разделе: (Показать все результаты (>5488) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~magepie/projects/term3/pm_same.txt
• http://kodomo.cmm.msu.ru/~cherry1989/term3/all_blastn.txt
• http://kodomo.cmm.msu.ru/~nihilenia/term3/BLAST/pm_search.txt

... Another way to fend off and detect impostors is to use call sequence checks. Call sequence checks help you protect against intruders that somehow managed to find out the password you log into your UUCP system with. ... When the attacker call your UUCP feed and steals your mail, this will increase the feeds call sequence number by one. ... If you have enabled call sequence checks, you should check your log files regularly for error messages that hint at possible attacks. ...

Еще в разделе: (Показать все результаты (>94) - itpm.msu.su/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Taylor & Francis . Местоположение издательства: United Kingdom . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены. обратная связь . Создать

Еще в разделе: (Показать все результаты (>2812) - istina.msu.ru/ )

• Journal of Integer Sequences - журнал | ИСТИНА - Интеллектуальная Система
• Protein sequences & data analysis - журнал | ИСТИНА - Интеллектуальная Система
• METHOD FOR SIMULTANEOUSLY DETECTING A PLURALITY OF RNA SEQUENCES IN A

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... WikiNotation 2 - 1999-12-14 - PeterThoeny . ... TWiki is linking topics automatically, provided you give a WikiTopic a name that follows the WikiNotation . ... TWiki links topics automatically, provided you give a WikiTopic a name that follows the WikiNotation . ... Uppercase letter(s) . Lowercase letter(s) . ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.WikiNotation . ...

Еще в разделе: (Показать все результаты (>28409) - dualopt1.cmm.msu.ru/ )

• WikiNotation - TWiki - TWiki
• %TOPICTITLE% (2 vs. 3) - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Algorithm Format requirements
• RNA Alignment

. [ Войти ] . Главная -> Фильмы -> The Lost Spider Pit Sequence . Пользователи . Демо . Деньги . Фильмы . Форум . The Lost Spider Pit Sequence . Новая Зеландия 2005 . отметить . Фантастика . Ужасы . Триллер .

Еще в разделе: (Показать все результаты (>127) - kinfo.ru/ )

... Главная последовательность (ГП) - наиболее населенная область на диаграмме Гецшпрунга - Рессела (ГР). ... Основное время жизни звезда проводит на главной последовательности и поэтому главная последовательность - наиболее населенная группа на диаграмме ГР (до 90% всех звезд лежат на ней). ... Для звезд главной последовательности существует апроксимационное соотношение, известное как зависимость масса-светимость. ... Звезды проводят большую часть своей жизни на главной последовательности. ... 33,000 ....

Еще в разделе: (Показать все результаты (>1287) - crydee.sai.msu.ru/ )

• Standard Schoolhouse Rock Introduction Sequence

... x264 is an open source codec of standard MPEG4 AVC/H.264, developed by programmers from all over the world. ... Accumulated during previous frames' compressions statistic is actively used by codec to improve effectiveness of adaptive models. ... These parameters are used only before encoding start, so, our improvements are more significant for short sequences. ... 3 Results of codec x264 modification on "flower" sequence . ... 5 Results of codec x264 modification on "flower" sequence, low bitrates ....

Еще в разделе: (Показать все результаты (>135) - graphics.cs.msu.ru/ )

• Novel Approach for Video Codecs Scoring using Specially Prepared Video
• Video Matting Benchmark | Graphics and Media Lab Equation Equation Equation
• x264 codec improvement | Лаборатория компьютерной графики и мультимедиа

... Content Model: Optional list header (LH), followed by one or more list items (LI) . An ordered list typically is a numbered list of items. ... The numbering style is left to associated style sheets, e.g. whether nested lists contribute to a compound item number, e.g. "3.1.5", or whether numbers are rendered as arabic, upper or lower case roman numerals or using the numbering scheme appropriate to the language context. ... CLASS . ... The CLEAR attribute allows you to move down unconditionally: . ...

Еще в разделе: (Показать все результаты (>89) - comet.sai.msu.ru/ )

• Headings
• List Item
• UNIXhelp Glossary - "P"

... Give an example of chemical reaction between a salt and an acid leading to the formation of another salt and a base. (1 point) [Solution] . ... Write the reactions of chromium (III) bromide with hydrogen peroxide in acidic and basic media. (2 points) [Solution] . ... In the reactions, specify the structures of all substances. (3 points) [Solution] . ... Three substances A, B, and C were mixed in the amount of three moles each. ... Example problems in chemistry for the entrance exams ( main round ) ....

Еще в разделе: (Показать все результаты (>136) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 52, No. 3, P. 175 (2011)
• Книги сотрудников факультета (2006)
• Спецкурсы кафедры "Химическая энзимология. Основы биоинформатики и

... DNA Sequence [DNA Sequence] . Common information . ... since 1989-01-01 till today . ... biology ->molecular biology . ... http://www.informaworld.com/smpp/titl.. ... today . ...

Еще в разделе: (Показать все результаты (>73) - journals.genebee.msu.ru/ )

... 2 ZERO-ORDERED SEQUENCES OF SPARSE VECTORS Let X = {xk } be a sequence of sparse vectors from Kn, I = {ik } be a sequence of multiindices. ... L ..... uL x1 ..... x1 ..... xn NNp-1 u1 u p-1 xn NNp-1 u1 NN p up-1 ..... up Let's consider a following sequential chain SPN of linked -neurons: u1 = spn1(x), up = spnp(x, up-1), 7 where p = 2, . ... We learn -neurons spn1, . ... Let's consider a following multy-layered network SPNN of -neurons: u1 = spn1(x), up = spnp(x, up-1), where p = 2, . ... SPNp-1(x))...

Еще в разделе: (Показать все результаты (>9) - acat02.sinp.msu.ru/ )

Моделирование процесса очистки сточных вод в реакторе типа SBR. Study on new dynamical model of sequencing batch reactor (SBR) and its simulation / Gan Shuying, Liu Zhenhong, Yang Qing, Chen Jihua // J. China Text. ... Реактор типа SBR (Sequencing batch reactor) - реактор периодического действия, отличается тем, что все стадии процесса биологической очистки сточных вод реализуются последовательно в одном объеме. ... биоочистка, водная среда, моделирование, оптимизация процесса . ...

15. Abstract

16. Heterogeneity in Northern Russian Alders

17. Change-points at different levels of the hierarchy of EEG segmental...

18. http://chaos.phys.msu.ru/loskutov/PDF/TechPhLt10_04_engl.pdf

19. A protein whose binding to Na,K-ATPase is regulated by ouabain.

20. staff:arzhantsev_s_a_publications | Кафедра высшей алгебры