... help . ... 1.6 + 1.7 +All position indexes are counting from 1. 1.8 + 1.9 + import optparse 1.10 + import sys 1.11 + import os 1.12 +from allpy import protein 1.13 + 1.14 +def main(): 1.15 + alignment = protein. Alignment .from_fasta(open(options.in_file)) 1.16 + if not options.begin: 1.17 + options.begin = 1 1.18 + if not options. end : 1.19 + options. end = len( alignment .columns) 1.20 + columns = ...

Еще в разделе: (Показать все результаты (>113171) - kodomo.fbb.msu.ru/ )

• allpy: bc1a7595d9d1
• allpy: cd43d59c0dba test/usecase3.py
• allpy: b556c96c6719 utils/realign_block.py

... help . ... See "hg help dates" for a list of formats valid for -d/--date. ... This has the same meaning as the corresponding patch option (default: 1) -e --edit invoke editor on commit messages -f --force skip check for outstanding uncommitted changes --no- commit don't commit , just update the working directory --bypass apply patch without touching the working directory --exact apply patch to the nodes from which it was generated -- import -branch use any branch information in ...

Еще в разделе: (Показать все результаты (>6073) - kodomo.cmm.msu.ru/ )

• petri_dish: 97768e4bbe61 bacteria.py
• petri_dish: 69a4724e7cac bacteria.py
• petri_dish: 2df48c61bd42 bacteria.py

... TWikiForms . ... Defining a Form Template . ... Form-based input in topics, with name/value pairs stored as Meta Data variables; choose one of multiple forms per web & topic . ... On upgrading from the previous TWiki, a Form Template topic has to be built for each web that used a Category Table, recreating the fields and values from the old twikicatitems.tmpl . ... The form topic name, fields and values are stored as TWikiMetaData - the order of the field/value pairs is the same as in the template. ...

Еще в разделе: (Показать все результаты (>37351) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (8 vs. 9) - TWiki

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>187) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/gmtselect.html
• http://xray.sai.msu.ru/~ivan/gmt/man/fitcircle.html
• http://xray.sai.msu.ru/~ivan/gmt/man/filter1d.html

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>143) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Genebee Predicted Annotation - Advanced
• AliComp - GeneBee Alignments Comparison - Advanced

Homepage: http://desandro.com/resources/jquery-masonry . ... Masonry is a layout plugin for jQuery. ... Whereas floating arranges elements horizontally then vertically, Masonry arranges elements vertically then horizontally according to a grid. ... Depending on the layout, you?ll most likely need to specify one option. ... Lorem ipsum dolor sit amet, consectetuer adipiscing elit. ... This topic: System > JQueryPlugin > JQueryMasonry . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>4875) - wiki.cmc.msu.ru/ )

• PatternSkinTheme < System < Foswiki

. Some commands accept multiple options. These can be grouped together after a single hyphen: command -abc argument . A small number of commands require each option to be given separately. Check the command synopsis for a command to see how a command requires its options to be given. An option that takes an argument, such as the name of a printer or a filename is given separately. Examples .

Еще в разделе: (Показать все результаты (>265) - comet.sai.msu.ru/ )

• Examples of using multiple options
• Command options
• rtftohtml Users Guide - 6 Command Line Options

... Algorithm & . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). The analysis begins with a multiple alignment of a protein family. ... Predict SDPs only . Predict CPs only . Predict SDPs and CPs . Map a pre-identified list of SDPs and/or CPs onto a structure ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPlight
• SDPpred

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>398) - monkey.belozersky.msu.ru/ )

• About this project
• SDPpred
• Example of supporting positions

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>6532) - crydee.sai.msu.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>585) - uneex.lorien.cs.msu.su/ )

• dbmmanage - Manage user authentication files in DBM format - Apache HTTP Server
• ab - Apache HTTP server benchmarking tool - Apache HTTP Server
• Macros

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>232) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinCommand - UNИX
• HelpOnInstalling/TwistedWeb - UNИX
• HelpOnInstalling/StandaloneServer - UNИX

... Usage ---+++ <nop>JavaScript API Configuring Masonry is fairly easy. ... For layouts with elements that span multiple widths: <verbatim class="js"> $('#wrapper').masonry({ columnWidth: 200 }); </verbatim> For layouts with elements that span the same width: <verbatim class="js"> $('#wrapper').masonry({ singleMode: true }); </verbatim> ---+++ Foswiki integration All containers classified as =jqMasonry= will be processed by this plugin. ... This topic: System > JQueryPlugin > JQueryMasonry . ...

Еще в разделе: (Показать все результаты (>1797) - wiki.cs.msu.ru/ )

... Options for
<tt> mpirun
</tt> . ... mpirun [mpirun_options...] <progname> [options...] . mpirun _ options : - arch architecture specify the architecture (must have matching machines. arch file in ${MPIR_HOME}/bin/machines) if using the execer -h This help -machine machine name use startup procedure for machine name -machinefile machine-file name Take the list of possible machines to run on from the file machine-file ... Special Options for Nexus device: . ... Центры . ...

Еще в разделе: (Показать все результаты (>350) - www.parallel.ru/ )

• mpirun | PARALLEL.RU - Информационно-аналитический центр по параллельным

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>3) - www.ied.msu.ru/ )

Электронная библиотека Попечительского совета . ... Acklen L., O'Brien P. - Special Edition Using WordPerfect Office X3 . ... Название: Special Edition Using WordPerfect Office X3 . Авторы: Acklen L., O'Brien P. Аннотация: . Special Edition Using WordPerfect Office X3 is crammed full of tips, tricks, and practical examples that you won't find anywhere else! ... Address Book, WordPerfect Mail address book . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>4548) - lib.mexmat.ru/ )

• John C. Hull - Options, Futures, and Other Derivatives -Solution Manual ::
• Ballew J., Slack S.E. - Breakthrough Windows VistaT: Find Your Favorite
• Cardoza P. - Absolute Beginner's Guide to Microsoft Office OneNote 2003 ::

... Next: Scanners Up: Importing Images from Other Previous: Importing Images from Other Contents Index . ... Video or press button . The window where it is possible to select the driver will appear. Select the driver and press OK button, then the window, showing the movie from the videocamera will appear. Next time when the Command Video is selected or the button is pressed, the driver selection window won't appear any more, and the movie will be seen in a window. ...

Еще в разделе: (Показать все результаты (>69) - www.spm.genebee.msu.ru/ )

• Files Opening and Import
• Importing Images from Other Devices
• Changing Image Resolution

... Options . ... Possible options, which can be used in the command line to start LanHEP are: . ... InDir directory Set the default directory where to search files, which included by read and use statements. -tex LanHEP generates LaTeX files instead of CompHEP model tables. -frc If -tex option is set, forces LanHEP to split 4-fermion and 4-color vertices just as it is made for CompHEP files. -texLines num Set number of lines in LaTeX tables to num . ...

Еще в разделе: (Показать все результаты (>736) - theory.sinp.msu.ru/ )

• [Comphep-common] Privacy Options of mail list

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6977) - mouse.belozersky.msu.ru/ )

• NPG-explorer

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_import_jpeg -- Opens a JPEG image . int cpdf_import_jpeg ( int pdf document, string file name, float x-coor, float y-coor, float angle, float width, float height, float x-scale, float y-scale [, int mode]) . The cpdf_import_jpeg() function opens an image stored in the file with the name file name . ... The image is placed on the current page at position ( x-coor , y-coor ). ... The optional parameter mode determines the unit length. ...

Еще в разделе: (Показать все результаты (>663) - oit.cmc.msu.ru/ )

• printer_set_option
• PHP Options&Information
• ftp_set_option