log . ... Wed, 10 Nov 2010 12:01:26 +0300 . boris (netbook) . ... Tue, 09 Nov 2010 16:36:25 +0300 . ... boris . ... Sun, 31 Oct 2010 18:04:29 +0300 . ... Thu, 28 Oct 2010 20:35:29 +0400 . ... Wed, 27 Oct 2010 08:25:11 +0400 . ... Tue, 26 Oct 2010 22:23:09 +0400 . ... Mon, 25 Oct 2010 13:30:11 +0400 . ... Sun, 24 Oct 2010 23:17:24 +0400 . ... allpy_pdb: new fasta id parsing function . ... Sat, 23 Oct 2010 23:57:51 +0400 . ...

Еще в разделе: (Показать все результаты (>112700) - kodomo.fbb.msu.ru/ )

To turn on filename completion set the shell variable filec by adding the line set filec . to your C shell startup file . To complete a file or directory name press the ESC key. ls -l on<ESC> line_help . If the filename is not completed enter more characters until the filename can be uniquely identified. Directories are shown by the trailing / character. ... cat co<CTRL-D> commands.xdh concepts.xdh conventions/ conver_man/ cat co . ...

Еще в разделе: (Показать все результаты (>186) - comet.sai.msu.ru/ )

• Filename completion with the Korn shell
• Filename completion with the Bourne Again SHell
• Filename completion with the TC shell

... About lab . ... Selected publications . ... Projects . ... Medical image analysis . ... Selected completed projects . Text recognition . Geometric image parsing . Multiple object detection . ... Old projects . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Text detection and recognition in natural images . ... 1) Automatic detection and understanding the text in natural images, such as photographs of city outdoors or building indoors, is a challenging problem. ...

Еще в разделе: (Показать все результаты (>240) - graphics.cs.msu.ru/ )

• Video processing | Graphics and Media Lab
• Graphics and Media Lab | CMC department, Lomonosov Moscow State University
• GML C++ Camera Calibration Toolbox | Graphics and Media Lab

... Progress . ... RMA calls must have local semantics, except when required for synchronization with other RMA calls. ... On the origin process, an RMA communication may become enabled as soon as the corresponding put, get or accumulate call has executed, or as late as when the ensuing synchronization call is issued. ... This code will deadlock: the wait of process 1 blocks until process 0 calls complete, and the receive of process 0 blocks until process 1 calls send. ... Центры . ...

Еще в разделе: (Показать все результаты (>580) - www.parallel.ru/ )

• Clarification of MPI_FINALIZE | PARALLEL.RU - Информационно-аналитический центр
• Return status | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Nonblocking communication | PARALLEL.RU - Информационно-аналитический центр по

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>263) - mccmb.belozersky.msu.ru/ )

• MCCMB'13

Hide Zen home . ... TODO . ... Tsearch Documentation TODO . ... README (Oleg) - Tsearch V2 Readme work in progress . Andy> I removed the TODOS .. ... Andy . Tsearch Reference (Brandon) . What needs to be completed for the Reference? ... I suggest just write by hand several .sql scripts for old tsearch, tsearch v2 </Oleg> <Andy> They are included in the latest tarball V2.1.6 correct? ... 0 Comments on tsearch documentation TODO This page is read-only View other revisions Administration . ...

Еще в разделе: (Показать все результаты (>2549) - www.sai.msu.su/ )

• SAL -- Scientific Applications on Linux -- New Items Added in 1998/09 and
• SAL -- Scientific Applications on Linux -- New Items Added in 1997/12
• APOD: 2011 March 9 - The International Space Station Expands Again

Электронная библиотека Попечительского совета . ... Bousfield A., Kan D. - Homotopy limits, completions and localizations . ... Название: Homotopy limits, completions and localizations . Авторы: Bousfield A., Kan D. Аннотация: . ... Artin - Mazur completion III . ... Direct limit, homotopy XII . ... Homotopy, direct limit XII . ... Homotopy, inverse limit XI XI XI . ... Inverse limit, homotopy XI XI XI . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10967) - lib.mexmat.ru/ )

• Mosses P.D. (ed.) - CASL reference manual: the complete documentation of the
• Block L.S., Coppel W.A. - Dynamics in One Dimension :: Электронная библиотека
• McConnell S. - Code Complete :: Электронная библиотека попечительского совета

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... PatternSkinCssCookbook 4 - 2005-10-14 - Main.TWikiContributor . Line: 1 to 1 . ... PatternSkin uses 3 style sheets (attached to PatternSkin ): . ... When customizing your TWiki installation, you can either choose to completely rewrite all css styles, or to selectively override some styles. ... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . ...

Еще в разделе: (Показать все результаты (>41996) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (15 vs. 19) - TWiki
• %TOPICTITLE% (55 vs. 59) - TWiki
• %TOPICTITLE% (2 vs. 3) - TWiki

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: i just completed a whole powerpoint prese . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>3748) - www.sevin.ru/ )

mirroring wdcmirror ( ftp.wdc.com :/ drivers / hdutil ) completed successfully @ Thu Feb 27 00:45:37 MSK 1997 mirroring wdcmirror ( ftp.wdc.com :/ drivers / hdutil ) completed successfully @ Sun Mar 16 16:18:45 MSK 1997 Got INDEX.TXT 1613 Got allstar.exe 220223 Got wdatide.exe 72687 Got wd_diag.exe 60960 Got wd_clear.exe 54968 Got coretst.exe 33949 ...

Еще в разделе: (Показать все результаты (>5635) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/public/lyrics/cs-uwp/t/tangerine.dream/kiew_mission1
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom2/a-c/chaosbt2.txt
• http://crydee.sai.msu.ru/ftproot/pub/comp/hardware/cdr/jarnold/.mirror

PHP Manual . Prev . Next . PHP 4 ) yaz_wait -- Wait for Z39.50 requests to complete . int yaz_wait ( [ array options]) . ... yaz_wait() returns when all targets have either completed all requests or aborted (in case of errors). If the options array is given that holds options that change the behaviour of yaz_wait() . timeout . Sets timeout in seconds. If a target hasn't responded within the timeout it is considered dead and yaz_wait() returns. ...

Еще в разделе: (Показать все результаты (>689) - oit.cmc.msu.ru/ )

• LDAP functions
• readline_completion_function
• Parser behavior

... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>16) - cdfe.sinp.msu.ru/ )

... Bacteria rearranged . ... 2002) . ... Some improvements in Bacteria according Cavalier-Smith (2002b), Woese et al. (2000) and Wolf et al. 2001) . ... Several genera added (Patterson, 1999) . ... Cryothecomonas and Metopion moved (Kuhn et al., ... Major improvements and rearrangements to Protista (Stechmann, Cavalier-Smith, 2002; Cavalier-Smith, 2002; Cavalier-Smith, 2000) . ... Chaetognatha moved to Ecdysozoa, Nematomorpha to Nemathelminthes, Spiralia rearranged (Mallatt, Winchell, 2002) . ...

Еще в разделе: (Показать все результаты (>155) - herba.msu.ru/ )

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• Firefly/PC GAMESS DOCUMENTATION - XMCQDPT2
• PC GAMESS version 7.1 to version 7.1.5 update information

AC192956_1 [1 - 336] Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ... MPLLRQFAGVCVDAIPSDPTLLHFRHWLEKHHLSETLFEEVNTHLASLQLFIKRGSIVDA TIIHAPSSTKNRQNTRDPDMKATRKGNQCYCGMKAHIGVDAQTGLVHSLVGASANVADVT QVHHLLHGQEEVVHGDAGYKGVMRLSEHQHRVVTWRIPRWRVLALPGQGQQV >AC192956_7 [6996 - 6688] (REVERSE SENSE) Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ...

Еще в разделе: (Показать все результаты (>8429) - kodomo.cmm.msu.ru/ )

• / (log) тАУ Cyclyc Cell Automata
• Roadmap тАУ Python Battle
• Result summary blast-20091031-1941229237

... FIELD | ... java.lang.Object common.Task . ... public class Task . ... private java.lang.String . ... private boolean . ... private java.util.Vector . ... static int . ... private UserInfo . userInfo . ... void . ... Method Detail public void setUserInfo ( UserInfo userInfo) . ... public void setFiles (java.util.Vector in, java.util.Vector inout, java.util.Vector out) . public void setHost (java.lang.String host, java.lang.String prog, java.lang.String cgibin, java.lang.String cgibinLocal) . ...

Еще в разделе: (Показать все результаты (>27) - angel.cs.msu.su/ )

... Interface description . ... 6 Distributed array creating and deleting . ... 13.4 Access to elements of local part of distributed array . 13.4.1 Requesting if array element is allocated in local part of distributed array . ... 13.4.5 Coping element of local part of distributed array to element of local part of other distributed array . 13.4.6 Requesting address of element of local part of distributed array . ... 14.5 Access to distributed array elements, allocated in remote element buffer . ...

Еще в разделе: (Показать все результаты (>165) - sp.cs.msu.ru/ )

• Lib-DVM. Detailed design

... Next message: [RU-NGI] Fwd: CERN CA Website IP change . ... FYI -------- Original Message -------- Subject: [ LCG-ROLLOUT ] [ EGI BROADCAST ] Decommission of gridops.org completed Date : Mon, 4 Jul 2011 12:51:56 +0200 From: EGI BROADCAST cic-information at IN2P3.FR Reply-To: LHC Computer Grid - Rollout LCG-ROLLOUT at JISCMAIL.AC.UK To: LCG-ROLLOUT at JISCMAIL.AC.UK ------------------------------------------------------------------------------------------------------------- ...

Еще в разделе: (Показать все результаты (>664) - theory.sinp.msu.ru/ )

• [RU-NGI] Fwd: CERN CA Website IP change
• spamassassin - extensible email filter used to identify spam
• The RU-NGI Third quarter 2011 Archive by date

... Using Disks and Other Storage Media . ... The terminology is a bit confusing here: in MS-DOS, the word formatting is used to cover also the process of creating a filesystem (which will be discussed below). ... During formatting one might encounter bad spots on the disk, called bad blocks or bad sectors . ... Total capacity 1440 kB. ... Formatting ... done Verifying ... read: Unknown error $ The badblocks command can be used to search any disk or partition for bad blocks (including a floppy). ...

Еще в разделе: (Показать все результаты (>544) - itpm.msu.su/ )

• perchild - Apache HTTP Server
• Using NIS with Shadow Support
• mod_file_cache - Apache HTTP Server

You are here: Foswiki > System Web > Skins > PatternSkin > PatternSkinCssCookbook (18 Apr 2011, ProjectContributor ) E dit A ttach . ... Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... See example . ... System . ...

Еще в разделе: (Показать все результаты (>7277) - wiki.cs.msu.ru/ )

• PageOptimizerPlugin < System < Foswiki
• (backlinks in all Webs) ReleaseHistory < System < Foswiki
• (backlinks in System Web) ReleaseHistory < System < Foswiki