... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>1371) - monkey.belozersky.msu.ru/ )

• Molecular biology databases
• S publications

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12734) - lib.mexmat.ru/ )

• Thron W. - Introduction to the theory of functions of a complex variable ::
• Bass H. - Algebraic K-theory :: Электронная библиотека попечительского совета
• Hajime Sato - Algebraic Topology: An Intuitive Approach :: Электронная

... 5DPK structure . Page of complex: 5DPK . Home Browse Download Help About Us . ... PDB ID . ... MUTY ADENINE GLYCOSYLASE BOUND TO A TRANSITION STATE ANALOG (1N) PAIRED WITH D(8-OXOG) IN DUPLEXED DNA TO 2.2 A . ... View in . ... Protein chains: . DNA chains: . ... 5dpk.pdb1.pdb . ... Pfam domains . ... Download file with secondary structure created by Stride . 5dpk.pdb1.pdb: [ download sequences in FASTA format ] . ... Click "SHOW" for view sequence . ... NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>18) - npidb.belozersky.msu.ru/ )

• NPIDB: Home
• NPIDB: List of complexes
• NPIDB: Download

Sequin . Sequin is a program designed to aid in the submission of sequences to the GenBank, EMBL, and DDBJ sequence databases. ... http://www.ncbi.nlm.nih.gov/Sequin/ . ... Other Packages: Yes, ftp://ncbi.nlm.nih.gov/sequin/ . ... None . ... ftp://ncbi.nlm.nih.gov/sequin/ . ... User Comments: . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . Comments? SAL@KachinaTech.COM . Copyright 1995-2001 by Herng-Jeng Jou . ...

Еще в разделе: (Показать все результаты (>1594) - www.sai.msu.su/ )

• SAL- Numerical Analysis - Misc - Radix-2 Fast Fourier Transform
• APOD: 2008 March 27 - The N44 Complex
• APOD: 2012 December 19 - NGC 5189: An Unusually Complex Planetary Nebula

... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...

Еще в разделе: (Показать все результаты (>140) - itpm.msu.su/ )

• Be Paranoid-- Call Sequence Checks

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search

Previous article . Next article . ... Modeling calcium binding at the light harvesting complex of the bacterial photosynthetic center of Thermochromatium tepidum . ... Moscow University Chemistry Bulletin . 2011, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>797) - chem.msu.ru/ )

• Silicas modified by polyelectrolyte complexes for the ion chromatography of
• Molecular design of polydentate complexing agents: from topological analysis to
• Separation selectivity of anionic metal complexes of

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>287) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/37.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/155.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/30.pdf

... Астронет | ... Карта неба | ... Поле зрения . ... Размер карты . ... Предельная звездная величина: . ... Размер карты: примерный размер звездной карты в пикселях. ... Подписывать звездные величины: если установить данный флажок и задать пределы, на карте рядом со звездами соответствующего диапазона яркостей будут отбражаться их звездные величины без десятичной точки. ... Версия для печати - используйте эту ссылку для получения звездной карты в формате PDF, пригодном для высококачественной печати. ...

Еще в разделе: (Показать все результаты (>3886) - www.astronet.ru/ )

• Dusty Nebulae in Taurus
• Journal "Peremennye Zvezdy"
• A Twisted Solar Eruptive Prominence

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>583) - geo.web.ru/ )

• Sudbury Igneous Complex
• Dictionary_M
• Второе приглашение на научно-практическую конференцию "Современные методы

... A granular material is a conglomeration of discrete solid, macroscopic particles, which can move independently. Some examples of granular materials are coal, sand, rice, coffee, powders. Granular materials do not constitute a single phase of matter but have characteristics reminiscent of solids, liquids, or gases depending on the average energy per grain. If the average distance between granular particles exceeds their dimensions, such system is called granular gas. ...

Еще в разделе: (Показать все результаты (>260) - polly.phys.msu.ru/ )

• Sequence Design of Copolymers with Special Functional Properties - Chair of
• home2

... Контакты белка с ..... остатками 2'-дезоксирибозы . ... CB CYS 2983 chain L SG CYS 2983 chain L NH1 ARG 2082 chain L NZ LYS 2075 chain L NH1 ARG 882 chain K CB CYS 683 chain J SG CYS 683 chain J NH1 ARG 682 chain J SG CYS 483 chain I NH1 ARG 482 chain I CB CYS 283 chain H SG CYS 283 chain H NH1 ARG 282 chain H NZ LYS 275 chain H CE LYS 275 chain H . ... Цепь белка . ... IRF . ... То есть впринципе можно считать, что остаток ARG 882 chain K участвует в специфическом взаимодействии с молекулой ДНК. ...

Еще в разделе: (Показать все результаты (>3572) - kodomo.cmm.msu.ru/ )

• Complex with DNA
• Practice9(DNA-Protein complexes)

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>74) - www.intsys.msu.ru/ )

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>10) - astrometric.sai.msu.ru/ )

Construction of sequences of zeros and ones with complex finite sequences / A. Yu. ... Vestnik Moskovskogo Universiteta. Seriya 1. ... We construct infinite sequences of zeros and ones under some restrictions (not to contain subwords of some definite type or definite bits at definite positions, etc.) This paper concerns probabilistic methods of constructing such sequences with application of Lov sz lemma and their reformulation in terms of the Kolmogorov complexity and Martin-L f randomness. ...

Еще в разделе: (Показать все результаты (>201) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 3/2014

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6960) - mouse.belozersky.msu.ru/ )

• S : 3D_of_rm_system_components
• MTPro
• SVETKA, a program for multiple sequence alignments analysis

THE POST-SIMPOSIUM EXCURSION ( July 31 - August 7,1998 ) . ... The six-day excursion took the participants from Lanzhou via the western loess hill country to the north-eastern Tibetan Plateau and via the West Quinling Mountains back to Lanzhou. ... This section is 39m thick and contains the loess of the last glacial period as well as a basal complex of flood loam. In the latter, three poorly developed Ah-horizons can be identified. ...

Еще в разделе: (Показать все результаты (>121) - www.fadr.msu.ru/ )

п?я?п?пЎп?пЎпЄя?я?п?пЎ п©пЎп?я?пЇпЎп?п°я?п?п?я? Gnumeric . Prev . Next . ... COMPLEX(real,im[,suffix]) . ... Б•еп?я?я? @suffix я?я? 'i' я? я?я? 'j', COMPLEX я€я?п?я€пўп©п?п©я?п? я?п?я?я?пЇпі #VALUE!. п?п?п© п?пія?пЇпєя?п· п?я?я€я?я?п?п?я?я?п© п? Excel. COMPLEX(1,-1) пўп©я€я?п·я?п?п?п· 1-i. Prev . ... COMBIN . ... CONCATENATE ...

Еще в разделе: (Показать все результаты (>124) - uneex.lorien.cs.msu.su/ )

• The chaotic dimensionality of community building is far too complex for anyone

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>37) - analyt.chem.msu.ru/ )

• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by
• Molecular Mechanics Calculations of beta-Diketonate, Aqua, And

... Heterooligomeric complexes formed by human small heat shock proteins HspB1 (Hsp27) and HspB6 (Hsp20). ... Formation of heterooligomeric complexes of human small heat shock proteins (sHsp) HspB6 (Hsp20) and HspB1 (Hsp27) was analyzed by means of native gel electrophoresis, analytical ultracentrifugation, chemical cross-linking and size-exclusion chromatography. ... Inside of heterooligomeric complexes HspB6 inhibits phosphorylation of HspB1 by MAPKAP2 kinase. ...

Еще в разделе: (Показать все результаты (>85) - biochem.bio.msu.ru/ )

• Generation of superoxide by the mitochondrial Complex I.
• NADH/NAD+ interaction with NADH: ubiquinone oxidoreductase (complex I).
• Oligomeric adiponectin forms and their complexes in the blood of healthy donors