... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Keldysh Institute of Applied Mathematics of RAS . DRIVER: 3D numerical modelling of high energy density plasma physics . ... AREA: Plasma Physics . ... IMPACT: The expected results of numerical experiments will help to explain the observed statistical characteristics of molecular hydrogen clouds in external galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• Trainings on Application Development and Optimization | Moscow University
• APPLICATIONS: Astronomy | Moscow University Supercomputing Center
• Supercomputing Applications | Moscow University Supercomputing Center

Электронная библиотека Попечительского совета . ... Vassiliev V.A. - Applied Picard-Lefschetz Theory . ... Название: Applied Picard-Lefschetz Theory . Автор: Vassiliev V.A. Аннотация: . Many classical partial differential equations in mathematical physics and other applied sciences have integral representations, i.e., are defined by integrals depending on parameters. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>88511) - lib.mexmat.ru/ )

• Agarwal R.P., O'Regan D. - Fixed Point Theory and Applications :: Электронная
• Pilz G. - Near-rings: the theory and its applications :: Электронная библиотека
• Kaye L. - Mathematics of Logic: A Guide to Completeness Theorems and Their

Еще в разделе: (Показать все результаты (>70) - dfgm.math.msu.su/ )

• / Кафедра Дифференциальной геометрии и приложений /

... Русский English . Background . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Each of FBB students is to successfully complete and defend three yearly research projects, in bioinformatics, biochemistry, and bioengineering. ...

Еще в разделе: (Показать все результаты (>3) - en.fbb.msu.ru/ )

• BackgroundтАФ Faculty of Bioengineering and Bioinformatics, MSU

... Departments . ... Head of the department: Moiseev Evgeny, Academician of RAS, Professor, Dr. Sc., Dean of the Faculty CMC MSU Contact information . ... Main topics are: boundary value and spectral problems for PDEs of elliptic and mixed type, spectral analysis, boundary control problems for oscillating processes, linear integral equations, completeness and basis properties of functional systems. ... Functional Analysis by Prof. Moiseev, 64 hours, 5th semester. ... Functional Analysis by Assoc. ...

Еще в разделе: (Показать все результаты (>158) - en.cs.msu.ru/ )

• Department of Functional Analysis and its Applications
• Information for foreigners who wish to study at our Faculty
• Information for foreigners who wish to study at our Faculty | CMC MSU

Query [NEEDLEP-JobName:temp_job2] found 1 entries . Apply Options to: . ... Result Options . ... Link to related information: . ... View results using: . ... Aligned_sequences: 2 # 1: PYRD_HUMAN # 2: PYRD_METJA # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 311 # Identity: 90/311 (28.9%) # Similarity: 156/311 (50.2%) # Gaps: 35/311 (11.3%) # Score: 288.5 # # #======================================= PYRD_HUMAN 1 MLEVRVLGHKFRNPVGIAAG-FDKHGEAVDGLYKMGFGFVEIGSVTPKPQ 49 || ...

Еще в разделе: (Показать все результаты (>3408) - kodomo.cmm.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Daryina A.N. , Izmailov A.F. , Solodov M.V. в журнале Computational and Applied Mathematics , издательство Birkhaeuser (United States) , том 24, ? ...

Еще в разделе: (Показать все результаты (>4369) - istina.msu.ru/ )

• Technical Physics. The Russian Journal of Applied Physics - журнал | ИСТИНА -
• Annals of Pure and Applied Logic - журнал | ИСТИНА - Интеллектуальная Система
• Journal of Applied Mechanics and Technical Physics - журнал | ИСТИНА -

... application of the analytical transmission electron microscopy techniques for detection, identification and visualization of localization of nanoparticles of titanium and cerium oxides in mammalian cells]. ... This work represents the results of the study on applicability of the modern methods of analytical transmission electron microscopy for detection, identification and visualization of localization of nanoparticles of titanium and cerium oxides in A549 cell, human lung adenocarcinoma cell line. ...

Еще в разделе: (Показать все результаты (>96) - biochem.bio.msu.ru/ )

• Application of recombinant antibody fragments for troponin I measurements.
• Application of multipotent mesenchymal stromal cells from human adipose tissue
• Thermally induced structural changes of intrinsically disordered small heat

... This short review deals with the recent applications of in situ MAS NMR techniques for the unravel of the mechanisms of heterogeneous catalytic reactions. In the first part, the different approaches for realization of in situ MAS NMR experiments in static and flow conditions are considered. ... Laboratory of Kinetics and Catalysis ...

Еще в разделе: (Показать все результаты (>992) - chem.msu.ru/ )

• Application of the pattern-recognition method for modelling expert estimation
• Moscow University Chemistry Bulletin Vol. 50, No. 5, P. 317 (2009)
• Systematical Search for New Types of Chemical Interconversions: Mathematical

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... The Microsoft Machine Learning and Intelligence School will take place in Saint Petersburg, Russia, from July 29 to August 5, 2015. ... Qualified candidates should complete their applications by March 31, 2015. Acceptance decisions will be made around May 15, 2015. ...

Еще в разделе: (Показать все результаты (>354) - graphics.cs.msu.ru/ )

• Semiautomatic Visual-Attention Modeling and Its Application to Video
• Physiological meta-indicators for professional sports applications: express
• Scale Space Edge Curvature Estimation and Its Application to Straight Lines

... 2013/04/16 - 11:59am . ... After the education at High School of Management and Innovation graduates receive the state approved diploma of Lomonosov Moscow State University for a specialized educational programme "Strategic Management and Innovation" and become "Masters of Management". ... Admission procedure in 2013 in direction of "Management" for the programme "Strategic Management and Innovation" provides for contracts with 50 persons . ... 2006-2016 MSU Higher School of Management and...

Еще в разделе: (Показать все результаты (>28) - hsmi.msu.ru/ )

• Application for participation | MSU Higher school of management and innovation

... The documents on academic background should be translated into Russian and attested by the Russian Embassy in the country where the documents were issued, or by the Embassy of your country in Russia, or by a notary in Russia. Graduation certificate of the Center for International Education at MSU, or Preparatory Course at a state university in Russia, or Certificate of the Russian Language test and tests in Physics and Mathematics, . ... Russian Language Summer Program . ...

Еще в разделе: (Показать все результаты (>37) - foroff.phys.msu.ru/ )

• Programs, numerical algorithms

Open Conference Systems . ... Home > International Conference on Laser Application in Life Sciences (LALS-2014) . Ulm, Germany . ... 89081 Ulm, Germany . ... Ulm, DE . ... Following previous International Conferences on Laser Applications in Life Sciences (LALS), e.g. in Oulu, Taipei or Moscow, it is now our pleasure to invite you for LALS-2014 which will take place fromТ June 29 th to July 2Т  nd in "Edwin Scharff Haus" conferences center at Ulm/Neu Ulm (Germany) on the banks of the Danube river. ...

Еще в разделе: (Показать все результаты (>98) - hea.phys.msu.su/ )

• Call for Papers
• 2014 International Conference on Laser Applications in Life Sciences
• Browse Title Index

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>214) - ee-journal.spa.msu.ru/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... About Faculty . ... Research laboratories . The Natural Risk Assessment Laboratory . Field stations . ... Educational council . ... Type of field courses . ... How to apply . Application service . ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• How to apply
• Satino teaching and research station
• Department of Oceanology

A standard application form is available on the MSU site . ... The original document confirming the obtained level of education, indicating the qualification (or degree) and supplemented by the list of the undertaken courses and the received marks. ... A valid health certificate (Form 0.86) allowing the bearer to study in the Russian Federation, and at the History Faculty in particular (to be received in the MSU clinic № 222, upon the official request from the Faculty's International Office). ...

Еще в разделе: (Показать все результаты (>209) - hist.msu.ru/ )

... Time required to load first application IBM ValuePoint 466DX2/D Time to Load Word 6.0c 4 MB 8 MB 16 MB (seconds, lower is better) Windows 95 12.9 6.4 5.6 Windows for Workgroups 11.6 5.7 5.5 OS/2 Warp 101.3 21.8 16.2 Windows 95 % faster than 785% 341% 289% Warp Application Execution Performance To test the speed of application execution, Windows Magazine created benchmark macros for Word and Excel that execute a \wide variety of application functions. ... Application load time is not included. ...

Еще в разделе: (Показать все результаты (>4872) - crydee.sai.msu.ru/ )

• COMPLEX DATA ANALYSIS
• Wavelets and equations
• Notation

... 3 by_name = {} . 4 """A dictionary of default markup name -> markup class.""" . ... 6 def update ( * args ): . ... 12 for markup_class in args : . 13 class_name = markup_class . ... 15 globals ()[ class_name ] = markup_class . ... 20 if hasattr ( markup_class , 'name' ) and hasattr ( markup_class , 'kind' ): . ... 23 by_name [ fullname ] = markup_class . ... add_markup ( name , markup_class = cls ) . ... 39 def to_record ( self ): . ... 48 for number , monomer in enumerate ( self . ...

Еще в разделе: (Показать все результаты (>15621) - kodomo.fbb.msu.ru/ )

• allpy: afc8c5adb699 sandbox/ttk.py
• allpy: 2125782780c6 docs/Makefile
• allpy: 0ea281d09324

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... This section presents the results of the application of the methodology described in the previous section to real EEG signal. ... Fig. 7.1. Detection algorithm adapted for the EEG analysis . The EEG (a) was filtered in the alpha band (bandpass 7.5--12.5 Hz) (b) and then the amplitude squared (c); the result is the sequence from which the subintervals are cut out at further steps. ...

Еще в разделе: (Показать все результаты (>66) - brain.bio.msu.ru/ )

• Change-point analysis of the brain electrical activity
• Other prospects of the change-point based analysis
• Unsolved problems and new prospects

... Multi-Resolution FFT: MR FFT), .. STFT : ( . ... STFT), : , ?ґ , (Short Time Fourier Transform: STFT) . ... This approach is able to improve quality of many audio processing algorithms (such as noise reduction) by adaptively varying STFT time-frequency resolution based on local properties of the signal: estimates of spectrogram sparsity. ... The effect of this adaptive algorithm is selection of high frequency resolution for tonal signals and selection of high time resolution for transients. ...

Еще в разделе: (Показать все результаты (>250) - imaging.cmc.msu.ru/ )

• Publications | Laboratory of Mathematical Methods of Image Processing