1. http://lnfm1.sai.msu.ru/~olympiad/1997/files/prob1997prac.pdf
... 7-11 1997 . ... IV 24 ( 3 4 1997 .) , ( /). , 500 , 6 , 25,2 35,7 . ... 0 Delta 1.489 1.460 1.434 1.409 1.387 1.368 1.352 1.338 1.328 1.320 1.316 1.315 1.318 1.323 Deldot -25.61 -23.93 -22.08 -20.06 - 17.88 -15.54 -13.06 -10.45 -7.74 -4.96 -2.14 0.70 3.50 6.25 r 1.067 1.050 1.033 1.018 1.003 0.989 0.976 0.964 0.953 0.944 0.936 0.929 0.923 0.919 Theta 45.7 46.0 46.1 46.2 46.2 46.2 46.1 46.0 45.7 45.5 45.2 44.8 44.4 43.9 Beta 41.7 42.7 43.8 44.7 ...
[
]
http://lnfm1.sai.msu.ru/~olympiad/1997/files/prob1997prac.pdf -- 172.5 -- 13.11.2006
:
(
(>267) - lnfm1.sai.msu.ru/ )
2. DELTA
Gnumeric . Prev . Next . ... , #VALUE!. Excel. ... EXACT , GESTEP . ... DEGREES . ... DEVSQ ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
:
(
(>23) - uneex.lorien.cs.msu.su/ )
4. : Delta - Public forum of MSU united student networks
... -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . : Delta . ... Common . ... msu_td . ... Delta . ...
[
]
http://www.snto-msu.net/ratingdetails.php?username=Delta&showlite= -- 21.8 -- 10.04.2016
:
(
(>333) - www.snto-msu.net/ )
5. First Launch of the Delta IV Heavy
... First Launch of the Delta IV Heavy . ... 26.01.2005 . ... Credit: Ecliptic Enterprises Corporation , Boeing , USAF Explanation: The new Delta IV Heavy Launch Vehicle is the largest rocket ever to be launched by the US Air Force . ... The first launch of the Delta IV Heavy occurred last month and was largely successful with the exception that the boosters shut off several seconds prematurely. ... Pictured above , the Delta IV Heavy is seen lifting off by a RocketCam perched on its side. ... 2005 2006...
[
]
http://www.astronet.ru/db/xware/msg/apod/2005-01-26 -- 14.6 -- 26.01.2005
:
(
(>7758) - www.astronet.ru/ )
6. APOD: 2005 January 26 - First Launch of the Delta IV Heavy
... 2005 January 26 . First Launch of the Delta IV Heavy . ... Explanation: The new Delta IV Heavy Launch Vehicle is the largest rocket ever to be launched by the US Air Force . ... The first launch of the Delta IV Heavy occurred last month and was largely successful with the exception that the boosters shut off several seconds prematurely. ... Pictured above , the Delta IV Heavy is seen lifting off by a RocketCam perched on its side. ... About APOD | ...
[
]
http://www.sai.msu.su/apod/ap050126.html -- 5.2 -- 02.10.2012
:
(
(>251) - www.sai.msu.su/ )
7. , i ($\delta,\theta$)
. ... Ex Libris Wanted . ... . ... ., . - . ... , 2004-2016 . ...
[
]
http://lib.mexmat.ru/showsubject/708121 -- 11.7 -- 13.04.2016
:
(
(>977) - lib.mexmat.ru/ )
8. W Delta Z - - Kinfo.ru
... -> -> W Delta Z . ... . ... W Delta Z . ... 2007 . ... Tom Shankland . ... Tom Hardy . ... Peter Ballance . ... Alibe Parsons . ... Barbara Adair . ... Selma Blair . ...
[
]
http://kinfo.ru/Movie/02562774-9c3f-4a07-abc7-00a26b966329 -- 8.6 -- 11.04.2016
9. Index of /pub/gentoo-portage/app-text/delta/
. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:20:02 . 2.3K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 1.9K . application/octet-stream . Manifest . 2016-Jan-25 18:20:02 . 1.8K . application/octet-stream . delta-20060803.ebuild . 2015-Aug-09 03:38:18 . 0.7K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.5K . text/xml . lighttpd/1.4.35
[
]
http://mirror.msu.net/pub/gentoo-portage/app-text/delta/ -- 3.2 -- 10.04.2016
:
(
(>805) - mirror.msu.net/ )
10. http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
sp|P0C6M3|LHDAG_HDVP1 Large delta antigen ; MSQTVARLT-SKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLL- RRKKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGG KHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPF SRTGEGIDIRGTQQFPWYGFTPPPPGYYWVPGCTQQ sp|Q81842|SHDAG_HDVP1 Small delta ...
[
]
http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta -- 9.8 -- 20.04.2009
[
]
http://kodomo.cmm.msu.ru/~lesya/images/delta_muscle.fasta -- 9.8 -- 24.05.2009
:
(
(>1005) - kodomo.cmm.msu.ru/ )
11. DELTA ABRASIMET
.
[
]
http://www.chemport.ru/labequipment_products1052.html -- 13.8 -- 11.04.2016
:
(
(>11) - www.chemport.ru/ )
12. http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps
Lambda ########### f : X \Theta X ! ... f \Gamma1 = ffi f ffi , ### (a; b; c; d) = (\Gammaa; b; \Gammac; d). ##############. ##### ############ ##### #########, ### ########### f r (a; b; c; d) = i a + ab + bc; bcd bc + a(1 + b)(1 + d) ; acd a + c + ad ; bc + a(1 + b)(1 + d) c j ; (3) ########## ## f ####### ######## +; \Gamma; max ## \Delta; =; + ##############, ######## ############ ####-- ######## ## R 2 + . ... Quantum groups (Leningrad, 1990), 1--8, Lecture Notes in Math., ... Math. ...
[
]
http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps -- 138.0 -- 22.02.2005
:
(
(>27) - higeom.math.msu.su/ )
14. Index of manual pages: S
... Manual pages are often copyrighted material. ... If these links return an error message, view the page locally instead. sccs - front end for the Source Code Control System (SCCS) . sccs-admin , admin - create and administer SCCS history files . sccs-cdc , cdc - change the delta commentary of an SCCS delta . ... sccs-prs , prs - display selected portions of an SCCS history . sccs-prt , prt - display delta table information from an SCCS file . ... size - display the size of an object file . ...
[
]
http://comet.sai.msu.ru/UNIXhelp/alphabetical/ms.html -- 6.7 -- 17.01.1997
:
(
(>154) - comet.sai.msu.ru/ )
15. MAREZIO M. - | -
: \ . ... . ... Capponi J.J. , Kopnin E.M. , Loureiro S.M. , Antipov E.V. , Gautier E. , Chaillout C. , Souletie B. , Brunner M. , Tholence J.L. , Marezio M. Physica C , 256, ? 1-2, . 1-7 DOI . ... 3-4, . 401-406 DOI . ... 2, . 406-409 DOI . ... 3-4, . 265-272 DOI . ... 5130, . 97-99 DOI . ...
[
]
http://istina.msu.ru/workers/455271/ -- 44.4 -- 10.04.2016
:
(
(>343) - istina.msu.ru/ )
16. > !
... : ! > > . Delta . ... 10- 11- . ... , ? . ... , ? ... , , "" . ...
[
]
http://wasp.phys.msu.ru/forum/lofiversion/index.php?t2718.html -- 9.3 -- 11.04.2016
:
(
(>150) - wasp.phys.msu.ru/ )
17. allpy: 0c3c1856113a
... allpy/base.py allpy/pdb.py . ... allpy/base.py . ... allpy/pdb.py . ... 1.1 --- a/ allpy /base.py Thu Dec 16 20:45:57 2010 +0300 1.2 +++ b/ allpy /base.py Thu Dec 16 20:47:09 2010 +0300 1.3 @@ -380,61 +380,6 @@ 1.4 string = ''.join([m.type.code1 if m else '-' for m in block_monomers]) 1.5 save_fasta(out_file, string, sequence .name, sequence .description, long_line) 1.6 1.7 - def geometrical_cores(self, max_ delta =config. delta , 1.8 - timeout =config. timeout , minsize=config.minsize, 1.9 - ...
[
]
http://kodomo.fbb.msu.ru/hg/allpy/rev/0c3c1856113a -- 18.6 -- 01.10.2012
:
(
(>2522) - kodomo.fbb.msu.ru/ )
18. p32.mpc | PARALLEL.RU - -
... p32.mpc . include stdio.h # include stdlib.h # include math.h # include mpc.h # define DELTA (0.5) typedef struct { double len ; double wid ; double hei ; double mass ; } rail ; nettype HeteroNet ( int n , double v [ n ]) { coord I = n ; node { I =0: v [ I ];}; parent [0]; }; double Density ( double x , double y , double z ) { return 6.0* sqrt ( exp ( sin ( sqrt ( x * y * z ) ) ) ); } double RailMass ( ... . ...
[
]
http://www.parallel.ru/tech/mpc/p32.html -- 18.0 -- 09.04.2016
:
(
(>29) - www.parallel.ru/ )
19. SCOP classification
... Resolvase-like . ... gamma,delta resolvase, catalytic domain . protein domain . ... Escherichia coli [TaxId: 562] . ...
[
]
http://monkey.belozersky.msu.su/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 04.02.2013
[
]
http://mouse.belozersky.msu.ru/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 05.02.2013
[
]
http://monkey.belozersky.msu.ru/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 04.02.2013
:
(
(>3186) - monkey.belozersky.msu.ru/ )
20. http://xray.sai.msu.ru/~ivan/gmt/man/grdvolume.html
grdvolume - Calculating volume under a surface within a contour grdvolume grdfile [ -C cval or -C low / high / delta ] [ -L base ] [ -R west / east / south / north [ r ] ] [ -S [ k ] ] [ -T ] [ -V [ l ] ] [ -Z fact [/ delta ] ] grdvolume reads a 2-D binary grd file and calculates the volume contained between the surface and the plane specified by the given contour (or zero if not given). ... Alternatively, search using all contours from low to high in steps of delta . ... Default is no scaling]. ...
[
]
http://xray.sai.msu.ru/~ivan/gmt/man/grdvolume.html -- 4.7 -- 19.03.1999
:
(
(>97) - xray.sai.msu.ru/ )