lcms: lcms (little cms engine) lcms: lcms: Little cms is a small, speed optimized color management engine. lcms: lcms: lcms was written by Marti Maria <marti@littlecms.com>. lcms: lcms: lcms: lcms: lcms: lcms:

Еще в разделе: (Показать все результаты (>14322) - mirror.msu.net/ )

This page is a reference for all CSS classes used in PatternSkin . ... Page type classes . ... TWiki specific classes (emitted by the TWiki engine) have the prefix twiki : twikiButton, twikiToc, etcetera. ... All templates that are not the view template have the body class name "patternNoViewPage". ... patternScreen - outer container, used when centering the page (see PatternSkinCssCookbookCenterPage ) . ... Left bar: . ... patternTopBarContents - header art / logo; contains topic WebTopBar . ...

Еще в разделе: (Показать все результаты (>35770) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• PatternSkinCssCookbook - TWiki - TWiki

Contents] [Prev page] [Next page] [Index] . ... Positioning HTML Content Using Styles . Positioning HTML Content Using the <LAYER> Tag . ... Absolute Positioning . ... Creating Positioned Blocks of Content Dynamically . Writing Content in Positioned Blocks . ... Positioning the Flower Layers . Positioning and Moving the Fish and Poles . Defining the onLoad Handler for the BODY Element . ... Adding Another Layer to Contain the Reverse Fish Image . ... The Initialization Functions . ...

Еще в разделе: (Показать все результаты (>16456) - crydee.sai.msu.ru/ )

• Background color examples
• Colors and backgrounds
• Property index

... file . ... line source . 1 """Guts of snakes.""" . ... 5 def preprocess ( line ): . 6 """Remove comments and junk spaces from line of snake definition file.""" . ... 14 def __init__ ( self , file ): . ... 21 def enumerate_lines ( self ): . ... 31 - `cells` -- list of cells belonging to the snake The first of these cells . ... 43 def load ( self , file ): . ... 108 assert len ( line ) == 8 , "Rule lines must be exactly 7 chars long" . ... 117 def parse_cell ( self , x , y , char ): . ...

Еще в разделе: (Показать все результаты (>13859) - kodomo.fbb.msu.ru/ )

• snake: 59c2be771f94 snake.py
• snake: fde515c7a4c8 engine.py
• cca: 94406d1874a2 State.py

Astronomy Picture of the Day . ... B.J. Mochejska , J. Kaluzny ( CAMK ), 1m Swope Telescope Explanation: This color "picture" of globular star cluster M55 may not look like any star cluster you've ever seen. ... In the picture, a Color Magnitude Diagram (CMD), M55's individual stars are represented as dots whose color indicates relative temperature, red (cool) to blue (hot). ... Publications with keywords: color - magnitude - diagram - cmd - m55 - star - stellar evolution . ...

Еще в разделе: (Показать все результаты (>13106) - www.astronet.ru/ )

• Астронет > M55 Color Magnitude Diagram
• Southern Cross Star Colors
• Астронет > Southern Cross Star Colors

... 2001 February 23 . M55: Color Magnitude Diagram . ... Explanation: This color "picture" of globular star cluster M55 may not look like any star cluster you've ever seen. ... In the picture, a Color Magnitude Diagram (CMD), M55's individual stars are represented as dots whose color indicates relative temperature, red (cool) to blue (hot). ... M55's stars were formed at the same time and at first were all located along the main sequence by mass, lower mass stars at the lower right. ... About APOD | ...

Еще в разделе: (Показать все результаты (>3130) - www.sai.msu.su/ )

• APOD: 2004 July 8 - Southern Cross Star Colors
• APOD: 2009 December 10 - The Colors of IC 1795
• APOD: 2015 August 31 - Pluto in Enhanced Color

... See program design docs for file syntax. for line in file : magic, name = preprocess( line ).split(' ', 1) break assert magic == snake , This is not snake file for line in file : line = preprocess( line ) if line == 'end': break assert line == '', Rules must be separated by empty lines self .rules.append( Rule ( self ).load( file )) ...

Еще в разделе: (Показать все результаты (>3942) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/snake/browser/snake.py?rev=70%3Ae8eabd9530a1&format=txt
• http://kodomo.cmm.msu.su/trac/snake/browser/snake.py?rev=2d4b7e24d914ee6b3b6b916167109e0feb447462&format=txt
• http://kodomo.cmm.msu.su/trac/snake/browser/snake.py?rev=111%3A9486211ec334&format=txt

... Barnette D. - Map Coloring Polyhedra and the Four Color Problem . ... Название: Map Coloring Polyhedra and the Four Color Problem . ... In the summer of 1976 Kenneth Appel and Wolfgang Haken of the University of Illinois announced that they had solved the Four-Color Problem. Suddenly what had been known to several generations of mathematicians as the Four-Color Conjecture had become the Four-Color Theorem. ... MAP 25 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9928) - lib.mexmat.ru/ )

• Nassau K. - Color for Science, Art and Technology :: Электронная библиотека
• Bechtold T. (ed.), Mussak R. (ed.) - Handbook of natural colorants ::
• Stapfer H.-H., Greer D. (Illustrator) - MiG-21 Fishbed in color :: Электронная

... The CompHEP Lagrangian tables do not describe explicitly the color structure of a vertex. ... for three color octets. ... Each vertex containing 4 color particles is split to 2 vertices which are joined by an automatically generated auxiliary field. ... Instead of evaluating this expression and that splitting all vertices independently, one can introduce one color octet auxiliary field and write this Lagrangian term as . ... enable vertex level splitting (only for vertices with 4 color particles). ...

Еще в разделе: (Показать все результаты (>365) - theory.sinp.msu.ru/ )

• Declaration of new index types and indexed objects
• Getting started with LanHEP

MAKETEXT{"Why am I being asked to confirm?" ... STARTSECTION{ you }%% MAKETEXT { You }%%ENDSECTION{ you }% %STARTSECTION{ ok }%% MAKETEXT { OK }%%ENDSECTION{ ok }% %STARTSECTION{ cancel }%% MAKETEXT { Cancel }%%ENDSECTION{ cancel }% %STARTSECTION{ webserver }%% MAKETEXT { Webserver em running Foswiki /em }%%ENDSECTION{ webserver }% %STARTSECTION{ dialog }%% This topic: System > FAQWhyYouAreAskedToConfirm . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>3616) - wiki.cmc.msu.ru/ )

• PatternSkinCss < System < Foswiki
• PatternSkinCssCookbook < System < Foswiki

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>177) - graphics.cs.msu.ru/ )

• Image colorization | Graphics and Media Lab
• Image colorization | Лаборатория компьютерной графики и мультимедиа
• High-quality increase of video color depth | Graphics and Media Lab

... delete line . ... ncurses_clrtobot -- Clear screen from current position to bottom . ncurses_clrtoeol -- Clear screen from current position to end of line . ... ncurses_hline -- Draw a horizontal line at current position using an attributed character and max. n characters long . ... ncurses_insch -- Insert character moving rest of line including character at current position . ... ncurses_vline -- Draw a vertical line at current position using an attributed character and max. n characters long . ...

Еще в разделе: (Показать все результаты (>251) - oit.cmc.msu.ru/ )

• ncurses_can_change_color
• ncurses_assume_default_colors
• ncurses_has_colors

... Главная -> Фильмы -> Colors . ... Фильмы . ... Colors . ... Dennis Hopper . ... Lawrence Cook . ... Dennis Fanning . ... Lawrence Lowe . ... Сюжет . В Лос-Анджелесе 600 уличных банд. В них состоях 70 000 человек. В 1987 году в стычках было убито 387 человек. Что стоит за кровавой статистикой, приведенной в начальных титрах фильма? ... Сюжет романтизируется любовью Пенна к девушке (Алонсо), состоящей в одной из банд. ...

Еще в разделе: (Показать все результаты (>3506) - kinfo.ru/ )

• The Little Engine That Could - Фильмы - Kinfo.ru
• Colors (Цвета) [1988] - Фильм - Фильмы - Kinfo.ru
• Red Is the Color of - Фильмы - Kinfo.ru

... Character data . ... This section of the specification describes the basic data types that may appear as an element's content or an attribute's value. ... The syntax of valid character data in HTML is defined in terms of the SGML concepts of NAME and CDATA. ... Although the STYLE and SCRIPT elements use CDATA for their data model, for these elements, CDATA must be handled differently by user agents. ... The attribute value type "color" ( %Color ) refers to color definitions as specified in [SRGB] . ...

Еще в разделе: (Показать все результаты (>280) - itpm.msu.su/ )

... MPE_Draw_line . Draws a line on an X11 display #include <stdio.h> #include "mpe.h" int MPE_Draw_line( handle, x1, y1, x2, y2, color ) MPE_XGraph handle; int x1, y1, x2, y2; MPE_Color color; . handle . MPE graphics handle . ... pixel position of one end of the line to draw. Coordinates are upper-left origin (standard X11) . ... pixel position of the other end of the line to draw. ... color . Color index value. ... Центры . ...

Еще в разделе: (Показать все результаты (>127) - www.parallel.ru/ )

• MPE_Fill_rectangle | PARALLEL.RU - Информационно-аналитический центр по
• MPE_Draw_point | PARALLEL.RU - Информационно-аналитический центр по
• MPE_Make_color_array | PARALLEL.RU - Информационно-аналитический центр по

The QPen class defines how a QPainter should draw lines and outlines of shapes. ... QPen ?(?const?QColor?&?color, uint?width=0, PenStyle?style=SolidLine?)? . ... uint? width ?()?const . ... A pen has a style, a width and a color. ... The pen width defines the line width. ... The pen color defines the color of lines and text. ... See the setStyle () function for a complete list of pen styles. ... Constructs a pen with a specified color, width and style. ... Sets the pen color to c. See also: color (). ...

Еще в разделе: (Показать все результаты (>231) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBrush Class
• Qt Toolkit - QColorGroup Class
• Qt Toolkit - QPalette Class

... Python . ... О UNИX . ... HelpOnFormatting . Неизменяемая страница . ... Colorize text . Colorize code (Syntax Highlighting) . ... Mixing ''italic'' and '''bold''' . ... Nesting curly braces . ... Markup . ... Result . ... Markup: {{{{ This is a preformatted text block. {{{ with curly braces inside }}} }}}} . Result: This is a preformatted text block. {{{ with curly braces inside }}} . Markup: {{{#!highlight python from colors import palette palette.colorize('python') }}} . ...

Еще в разделе: (Показать все результаты (>53) - uneex.mithril.cs.msu.su/ )

• Index of /static/DocsKdeOrg_KControl/kde3/ru/kdebase/kcontrol/colors
• HelpOnTables - UNИX
• Index of /static/AltDocs_informatika1/Book1/5_html/0_html/3_color

... Python . ... О UNИX . ... HelpOnFormatting . Неизменяемая страница . ... Colorize text . Colorize code (Syntax Highlighting) . ... Mixing ''italic'' and '''bold''' . ... Nesting curly braces . ... Markup . ... Result . ... Markup: {{{{ This is a preformatted text block. {{{ with curly braces inside }}} }}}} . Result: This is a preformatted text block. {{{ with curly braces inside }}} . Markup: {{{#!highlight python from colors import palette palette.colorize('python') }}} . ...

Еще в разделе: (Показать все результаты (>141) - uneex.lorien.cs.msu.su/ )

• Index of /static/DocsKdeOrg_KControl/kde3/ru/kdebase/kcontrol/colors
• Text Menu
• Format Menu

-microsoft-com:office:powerpoint xmlns:oa= urn:schemas-microsoft-com:office:activation o:shapelayout v: ext = edit o:idmap v: ext = edit data= 1 / /o:shapelayout p:colorscheme colors= #FFFFFF,#000000,#808080,#000000,#00CC99,#3333CC,#CCCCFF,#B2B2B2 / v:background id= _x0000_s1025 o:bwmode= white fillcolor= white [0] v: ...

Еще в разделе: (Показать все результаты (>54) - sai.msu.ru/ )

• http://www.sai.msu.ru/groups/cluster/gcvs/future/iaupraha.files/pres.xml

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>89) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced