. PHP Manual . Prev . Next . (3.0.4 - 3.0.18 only, PHP 4 >= 4.0.0) ifxus_read_slob -- Reads nbytes of the slob object . int ifxus_read_slob ( long bid, long nbytes) . Reads nbytes of the slob object. bid is a existing slob id and nbytes is the number of bytes read. Return FALSE on error otherwise the string. Prev . Home . Next . ifxus_seek_slob . Up . ifxus_write_slob

Еще в разделе: (Показать все результаты (>3049) - oit.cmc.msu.ru/ )

• imap_fetchstructure
• shmop_read
• socket_read

Электронная библиотека Попечительского совета . ... Clinger W.D. - How to Read Floating Point Numbers Accurately . ... Название: How to Read Floating Point Numbers Accurately . Автор: Clinger W.D. Аннотация: . Consider the problem of converting decimal scientific notation for a number into the best binary floating point approximation to that number, for some fixed precision. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>16077) - lib.mexmat.ru/ )

• Hingley P. - Forecasting Innovations: Methods for Predicting Numbers of Patent
• Bachman G. - Introduction to p-Adic Numbers and Valuation Theory :: Электронная
• Parshin A.N., Shafarevich I.R. (Ed) - Number Theory IV. Transcendental Numbers

... file . ... 7 def __new__ ( cls , file , format = "fasta" ): . ... 16 def __init__ ( self , file , wrap_column = 70 ): . ... 20 def write_string ( self , string , name , description = '' ): . 21 """Append one sequence to file.""" . ... 28 string = string [ self . ... 33 def write_strings ( self , sequences ): . ... 36 Sequences are given as list of tuples (string, name, description). 37 """ . 38 for string , name , description in sequences : . ... write_string ( string , name , description ) . ...

Еще в разделе: (Показать все результаты (>30830) - kodomo.fbb.msu.ru/ )

• allpy: ee2c10aa74b8 allpy/fileio.py
• allpy: a400b16f8d4e allpy/fileio.py
• allpy: 49d1ba7072a8 allpy/fileio.py

... This file is written in text format and consists from several sections. The order of this sections doesn't important. ... These sections should be described in the file: init , sample , var , var.scale (not nessesarly) , var.display (not nessesarly). ... init_read - Number of bytes needed to be read after string init have been sent. ... If additional data channel is enabled ( 2.1.2 ) during DSP board initialization it sends strings [init]init to chosen COM-port and reads [init]init_read bytes. ...

Еще в разделе: (Показать все результаты (>92) - www.spm.genebee.msu.ru/ )

• DAC numbers

... raid7 (1) raid7proxy(2) -- -- -- All objects within this MIB are prefixed with the OBJECT IDENTIFIER -- -- iso(1).org(3).dod(6).internet ... .enterprises(1). -- scc(1386).sccMibs(2).raid7Proxy(2) -- -- or, 1.3.6.1.4.1.1386.2.2 -- IMPORTS Gauge, Counter FROM RFC1155-SMI OBJECT-TYPE FROM RFC-1212 TRAP-TYPE FROM RFC-1215 DisplayString FROM RFC1213-MIB raid7proxy FROM SCC-ENTERPRISE-MIB; -- -- Groups within this ...

Еще в разделе: (Показать все результаты (>48266) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/mibs/private.mibs/scc-raid7-mib-v1-0.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc946.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc946.txt.pdf

... No input file or projection information are needed. ... CYLINDRICAL PROJECTIONS : -Jc lon0 / lat0 / scale (Cassini) -Jj lon0 / scale (Miller) -Jm scale ( Mercator - Greenwich and Equator as origin) -Jm lon0 / lat0 / scale ( Mercator - Give meridian and standard parallel) -Joa lon0 / lat0 / azimuth / scale (Oblique Mercator - point and azimuth) -Job lon0 / lat0 / lon1 / lat1 / scale (Oblique Mercator - two points) -Joc Je lon0 / lat0 / scale (Equidistant). ...

Еще в разделе: (Показать все результаты (>484) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdtrend.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdinfo.html
• http://xray.sai.msu.ru/~ivan/gmt/man/spectrum1d.html

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>127) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - TDHF
• Just CUDing: Firefly v. 7.1.G standard MP4(SDTQ) benchmark on NVidia GPUs or
• PC GAMESS/Firefly DOCUMENTATION - SMP, multicore and HTT features

The QFile class is an I/O device that operates on files. ... QFile  ( const char * name )  . ... virtual bool  open  ( int )  . bool  open  ( int, FILE * )  . ... The QDir class manages directories and lists of file names. ... Constructs a QFile with a file name name. ... Opens the file specified by the file name currently set, using the mode m. Returns TRUE if successful, otherwise FALSE. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ...

Еще в разделе: (Показать все результаты (>683) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBuffer Class
• Qt Toolkit - QDataStream Class
• Qt Toolkit - QTextStream Class

... Directives | ... Apache HTTP Server Version 2.0 . ... The most important directives used to control this MPM are ThreadsPerChild , which controls the number of threads deployed by each child process and MaxClients , which controls the maximum total number of threads that may be launched. ... Two directives set hard limits on the number of active child processes and the number of server threads in a child process, and can only be changed by fully stopping the server and then starting it again. ...

Еще в разделе: (Показать все результаты (>2029) - uneex.lorien.cs.msu.su/ )

• perchild - Apache HTTP Server
• Index of /static/AltDocs_informatika2/Book2/ch_10_prolog/11_number_task
• mod_logio - Apache HTTP Server

... USER MAILING LIST . ... TAGGING FOR SPAM MAILS . ... spamassassin - extensible email filter used to identify spam . ... Mail :: SpamAssassin Spam detector and markup engine Mail :: SpamAssassin ::ArchiveIterator find and process messages one at a time Mail :: SpamAssassin ::AutoWhitelist auto-whitelist handler for SpamAssassin Mail :: SpamAssassin ::Bayes determine spammishness using a Bayesian classifier Mail :: SpamAssassin ::BayesStore Bayesian Storage Module Mail :: ...

Еще в разделе: (Показать все результаты (>1685) - theory.sinp.msu.ru/ )

• The genEvents command
• [RU-NGI] Fwd: You have been assigned Ticket #2895
• Structure of LanHEP input file

To read the current message: <Return> . This will display the current message, as indicated by the > symbol. To display a message by its number: 5 . This will display the contents of message number 5. To display a range of messages by number: 4-7 . This will display messages 4 through 7, starting at message 4. ... To display all the messages from a specific user: p bob . This displays all the messages in your mailbox from the user bob , starting from the first message received. ...

Еще в разделе: (Показать все результаты (>389) - comet.sai.msu.ru/ )

• Reading commands
• Mail program modes
• Special shell variables

... Directives | ... Apache HTTP Server Version 2.0 . ... The most important directives used to control this MPM are ThreadsPerChild , which controls the number of threads deployed by each child process and MaxClients , which controls the maximum total number of threads that may be launched. ... Two directives set hard limits on the number of active child processes and the number of server threads in a child process, and can only be changed by fully stopping the server and then starting it again. ...

Еще в разделе: (Показать все результаты (>586) - itpm.msu.su/ )

• Creating a user
• perchild - Apache HTTP Server
• How to Dial a Number-- the dial File

... DevHlp_Security This devhlp allows to open a file for read access in the Init routine of a BASEDEV . ... returned: size of file SYIOpenFile ends Valid at INIT time only. ... This routine uses the corresponding function of the miniFSD , not normal file I/O, thus access is restricted. ... Although the size argument of the data structure implies, I'd recommend to better not read more than 32K at a time. ... DL = 044h This function will return the table of security helper functions for file access. ...

Еще в разделе: (Показать все результаты (>7198) - crydee.sai.msu.ru/ )

• Songs, HTML'd by Daniel Turner

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

... The particular variables it is concerned with are tick , which is the number of microseconds added to the system time during a clock interrupt, tickadj , which sets the slew rate and resolution used by the adjtime system call, and dosynctodr , which indicates to the kernels on some machines whether they should internally adjust the system clock to keep it in line with time-of-day clock or not. ... Set the kernel variable tickadj to an internally computed "optimal" value. -t tick . ...

Еще в разделе: (Показать все результаты (>2767) - www.sai.msu.su/ )

• Zen: FTS Notes
• SAL- Mathematics - Misc - Rascal
• Zen: SkyPixelization

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. Login | ... TWiki ? ... User mapping is the process by which TWiki maps from a username (a login name) to a display name and back. ... Users . ... handlesUser ObjectMethod handlesUser ($cUID,$login,$wikiname) -> $boolean . ... See baseclass for documentation. ... Convert a login name to the corresponding canonical user name. ... converts an internal cUID to that user's login (undef on failure) . ...

Еще в разделе: (Показать все результаты (>41306) - dualopt1.cmm.msu.ru/ )

• TWikiUsersBaseUserMappingDotPm - TWiki - TWiki - (printable)
• TWikiStoreRcsFileDotPm - TWiki - TWiki
• TWikiInfixParserDotPm - TWiki - TWiki - (printable)

... MPI . ... Add MPI to your path % set path = ( $path /usr/local/mpi/bin ) Compute pi to a given resolution on 8 processors or threads % mpirun -np 8 /usr/local/mpi/examples/basic/fpi Try 10000 intervals at the prompt. ... A coarse timing program is also available here % mpirun -np 8 /usr/local/mpi/examples/basic/systest More sophisticated timing programs may be found in the source for the MPICH implementation of MPI (/home/MPI/mpich/examples/perftest). ... See COPYRIGHT for details. ... Центры . ...

Еще в разделе: (Показать все результаты (>627) - www.parallel.ru/ )

• Data Access with Explicit Offsets | PARALLEL.RU - Информационно-аналитический
• MPI_File_read_at | PARALLEL.RU - Информационно-аналитический центр по
• MPI_File_read_at_all | PARALLEL.RU - Информационно-аналитический центр по

Series on Stability, Vibration and Control of Systems, Series A - Vol. ... MULTIPARAMETER STABILITY THEORY WITH MECHANICAL APPLICATIONS . ... This book deals with fundamental problems, concepts, and methods of multiparameter stability theory with applications in mechanics. ... Introduction to Stability Theory . ... Read Full Review . ... Since Bolotin's pioneering book on nonconservation problems on the theory of elastic stability, not many books appeared at such a high level, such as this one. ...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

... DESCRIPTION # # Computes combination between two (or more) .cube files (e.g. the output # of Siesta's grid2cube). ... added. # use strict; #-------------# # Variables # #-------------# my $svn_revision = r97 2007-06-29 18:02:55 ; my @ files ; # list of files to process my %do; # what to do with each file ( file = +1/-1) my $ atoms ; # string with atoms and geometry my %fb; # hash with file = [@bulk] info my @gnp; # (n1,n2,n3) - ...

Еще в разделе: (Показать все результаты (>50) - erg.biophys.msu.ru/ )

• http://erg.biophys.msu.ru/tpp/
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Python membrane generator for MD simulations ERG Research Group: Лаборатория

Description of accB gene from E.coli genome |Content |Information | Short gene name |accB | ... sequence | ... Protein id in UniprotKB |ID=BCCP_ECOLI | ... Full protein name |acetyl CoA carboxylase, BCCP subunit | ... carriers: biotin carboxyl carrier protein | ... Aminoacid sequence in fasta format: >BCCP_ECOLI acetyl CoA carboxylase MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAA EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPL VVIE ...

Еще в разделе: (Показать все результаты (>5097) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_03/doc/term3/EMBnet_unix.pdf
• Help: templating
• ENZYME search by EC Number