nmblookup - NetBIOS over TCP/IP client used to lookup NetBIOS names . nmblookup [ -M ] [ -R ] [ -S ] [ -r ] [ -A ] [ -h ] [ -B broadcast address ] [ -U unicast address ] [ -d debuglevel ] [ -s smb config file ] [ -i NetBIOS scope ] [ -T ] name . This program is part of the Samba suite. nmblookup is used to query NetBIOS names and map them to IP addresses in a network using NetBIOS over TCP/IP queries. ... S Once the name query has returned an IP address then do a node status query as well. ...

Еще в разделе: (Показать все результаты (>913) - oit.cmc.msu.ru/ )

• yp_master
• VirtualHost Examples

... Setup 1: The server machine has two IP addresses ( 111.22.33.44 and 111.22.33.55 ) which resolve to the names server.domain.tld and www.otherdomain.tld respectively. ... Port 80 DocumentRoot /www/domain ServerName www.domain.tld <VirtualHost 111.22.33.55> DocumentRoot /www/otherdomain ServerName www.otherdomain.tld .. ... Port 80 Listen 111.22.33.44:80 Listen 111.22.33.55:8080 ServerName server.domain.tld <VirtualHost 111.22.33.44:80> DocumentRoot /www/domain ServerName www.domain.tld .. ...

Еще в разделе: (Показать все результаты (>266) - rtm-cs.sinp.msu.ru/ )

• Bridging mini-Howto
• Apache module mod_example
• Apache name-based Virtual Hosts

Next: The SLIP and PPP Up: Interface Configuration for IP Previous: Configuring a Gateway . ... To activate the link, you have to configure the plip1 interface using the following commands: # ifconfig plip1 vlite pointopoint vlager # route add default gw vlager The first command configures the interface, telling the kernel that this is a point-to-point link, with the remote side having the address of vlager. The second installs the default route, using vlager as gateway. ...

Еще в разделе: (Показать все результаты (>507) - itpm.msu.su/ )

• mod_vhost_alias - Apache HTTP Server
• mod_example - Apache HTTP Server
• The Loopback Interface

To create a simple alias: alias del='rm -i' del memo.txt rm: remove memeo.txt? y . This creates the alias del for the command rm -i which prompts you for confirmation that you want to remove a file before it does so. ... To create a command alias that consists of several commands: alias what='ps -aux | ... To refer to another command alias within an alias: alias h=history alias rev='h | ... To use more than one alias on the same command line: alias root='cd /; ' alias slist='ls -l | ...

Еще в разделе: (Показать все результаты (>520) - comet.sai.msu.ru/ )

• Examples of creating command alias in the Korn shell
• Examples of creating command aliases in the TC shell
• Examples of creating a command alias in the C shell

Электронная библиотека Попечительского совета . ... Meyer J., Downing T., Shulmann A. - Java Virtual Machine . ... Название: Java Virtual Machine . ... The Java Virtual Machine is the software implementation of a "CPU" designed to run compiled Java code. ... The Java architecture is very open - it's easy to add programatic extensions to Java, once you have learned the basic rules of the Java Virtual Machine. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8384) - lib.mexmat.ru/ )

• Jacek F.Gieras - Axial Flux Permanent Magnet Brushless Machines :: Электронная
• Bishop C.M. - Pattern Recognition and Machine Learning :: Электронная
• Boerger E., Staerk R. - Abstract State Machines: A Method for High-Level System

Copyright 1999-2011 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ inherit eutils DESCRIPTION= Simple generator for Forth based BootMenu scripts for Pegasos machines HOMEPAGE= http :// tbs-software.com / morgoth /projects.html SRC_URI= http :// tbs-software.com / morgoth /files/bootcreator-src.tar.gz ...

Еще в разделе: (Показать все результаты (>21039) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sys-boot/bootcreator/bootcreator-1.2.ebuild
• http://mirror.msu.net/pub/gentoo-portage/net-misc/nstx/files/nstxd.conf
• http://mirror.msu.net/pub/gentoo-portage/net-misc/nstx/files/nstxcd.conf

... Port-based vhosts . ... Port 80 ServerName server.domain.tld NameVirtualHost *:80 <VirtualHost *:80> DocumentRoot /www/domain ServerName www.domain.tld .. ... Port 80 ServerName server.domain.tld NameVirtualHost 111.22.33.44 <VirtualHost 111.22.33.44> DocumentRoot /www/domain ServerName www.domain.tld .. ... Port 80 Listen 111.22.33.44:80 Listen 111.22.33.55:8080 ServerName server.domain.tld <VirtualHost 111.22.33.44:80> DocumentRoot /www/domain ServerName www.domain.tld .. ... VirtualHost> . ...

Еще в разделе: (Показать все результаты (>103) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache module mod_example
• Apache Virtual Host documentation

... From : Tony Rall Subject : Routing for OS/2 Summary : a mini FAQ for routing Keywords : routing slip proxy arp Organization : IBM Almaden Research Center (2:50/128.0@fidonet) Routing for OS/2 TCP/IP (Wherever "SLIP" is indicated below, any supported point-to-point protocol could be substituted. ... In SETUP.CMD, for machines such as L1 and L2, add: route -f add default L3 1 The network administrator should provide you with the router's IP address. ...

Еще в разделе: (Показать все результаты (>2173) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• Long description for example showing how structurally overlapping cells are
• One example

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>51) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1192) - kodomo.cmm.msu.ru/ )

• InterTrac тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata

Use the %INCLUDE{...}% variable to embed the content of another topic or web page inside a TWiki topic. ... Syntax Example . ... Include a topic MyTopic with two parameters . ... Alert Box using Parameterized Include . INCLUDE{ "page" pattern="reg-exp" rev="2" warn="off" section="clients" PARAMETER1="value" PARAMETER2="Some value"}% . ... Note: All text of a topic is included unless it contains a %STARTINCLUDE% and %STOPINCLUDE% , or you specify a section parameter and/or a pattern parameter. ...

Еще в разделе: (Показать все результаты (>40287) - dualopt1.cmm.msu.ru/ )

• IncludeTopicsAndWebPages - TWiki - TWiki
• %TOPICTITLE% (5 vs. 6) - TWiki

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>5916) - kodomo.fbb.msu.ru/ )

• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea state.py
• cca: a308291203ea .hgtags

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>41) - hist.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>158) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>52) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

Either several (at least two) Intel/AMD-based computers having identical or similar hardware configuration and running in the local network environment under the control of Windows NT 4.0, Windows 2000, Windows XP, Windows Server 2003, Windows Vista, Windows Server 2008, or Windows 7. ... The 32-bit NT-MPICH package (the part of MP-MPICH) must be installed, including MPI dynamic link libraries and cluster management service, on all computers to be used to run PC GAMESS/Firefly in parallel. ...

Еще в разделе: (Показать все результаты (>51) - classic.chem.msu.su/ )

• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... The Microsoft Machine Learning and Intelligence School will take place in Saint Petersburg, Russia, from July 29 to August 5, 2015. ... Qualified candidates should complete their applications by March 31, 2015. Acceptance decisions will be made around May 15, 2015. ...

Еще в разделе: (Показать все результаты (>229) - graphics.cs.msu.ru/ )

• Virtual Laboratory for Computer Graphics and Machine Vision | Graphics and
• Efficiency issues on Ray Tracing Machine | Graphics and Media Lab
• Convergence of Computer Graphics and Machine Vision (From the Editor of the