This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>1718) - crydee.sai.msu.ru/ )

• Long description of example illustrating hidden internal borders

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>711) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QSlider Class
• Qt Toolkit - layout/layout.cpp example file
• Qt Toolkit - QLabel Class

Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>7379) - mouse.belozersky.msu.ru/ )

• Alignment example
• Geometrical core

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Set table sorting by clicking headers "on" or "off" . ... Column to sort initially ( "1" to number of columns). unspecified . ... Data cell text colour, a comma separated list. unspecified . ... Vertical alignment of cells and headers, set to "top" , "middle" , "bottom" or "baseline" . ... Header cell alignment, one value for all columns, or a comma separated list for different alignment of individual columns. ... Header cell background colour of a sorted column. the value of headerbg . ...

Еще в разделе: (Показать все результаты (>40568) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (9 vs. 10) - TWiki
• TablePlugin - TWiki - TWiki

... MLNKLSAEFFGTFWLVFGGCGSAILAA--AFP------ELGIGFLGVALAF . ... SSLAPAG-FAPIAIGFGLTLIHLVSIPVTNTWVNPARSTG--VA--LF-----ADTAAL . ... MGRKLLAEFFGTFWLVFGGCGSAVFAA--AFP------ELGIGFTGVALAF . ... HGRVPAG-FAPIAIGLALTLIHLISIPVTNTSVNPARSTG--QA--LF-----VGGWAL . ... MSQT---STLKGQCIAEFLGTGLLIFFGVGCVA--ALKVAG------ASFGQWEISVI-W . ... ANQFTEG-LNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFL---PIPGKGSS . ... YPHFKATED-----QG-----AKLAVFSTDP-AIKHLPANFFSEVLGTFVLVLGILAIG- . ... MIDTSLATQFLGEVIGTAILIILGAGVVAGVSLKRSK------AENGGWVVITLAW...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Gallery of examples
• SDPpred

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>240) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SCOP famyli:
• SCOP famyli: T4 endonuclease V

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>161) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>777) - uneex.lorien.cs.msu.su/ )

• HelpOnImages - UNИX
• mod_example - Apache HTTP Server
• Issues Regarding DNS and Apache - Apache HTTP Server

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>6952) - wiki.cmc.msu.ru/ )

• JQueryGradient < System < Foswiki
• WysiwygPluginSettings < System < Foswiki

... Examples . ... The window at each process consists of array A , which contains the origin and target buffers of the put calls... while(!converged(A)){ update(A); MPI_Win_fence(MPI_MODE_NOPRECEDE, win); for(i=0; i < toneighbors; i++) MPI_Put(&frombuf[i], 1, fromtype[i], toneighbor[i], todisp[i], 1, totype[i], win); MPI_Win_fence((MPI_MODE_NOSTORE | ... Example Same generic example, with more computation/communication overlap. ... Центры . ...

Еще в разделе: (Показать все результаты (>416) - www.parallel.ru/ )

• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по
• An Application Example | PARALLEL.RU - Информационно-аналитический центр по
• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным

... Adds a gradient to the background of an element. ... Lorem ipsum dolor sit amet, consectetur adipiscing elit. Suspendisse ornare fringilla est, eget condimentum quam auctor quis. ... Phasellus tortor dui, viverra vitae molestie a, aliquam quis risus. Mauris fringilla mattis ligula, et laoreet dui rhoncus vel. Aliquam bibendum, nisi nec pellentesque convallis, augue elit rutrum sapien, nec molestie augue mauris et tellus. ... This topic: System > JQueryPlugin > JQueryGradient . ...

Еще в разделе: (Показать все результаты (>2221) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki

grdgradient - Compute directional derivative or gradient from 2-D grd file representing z(x,y) grdgradient in _ grdfile -G out _ grdfile [ -A azim [/ azim2 ] ] [ -D [ c ][ o ][ n ] ] [ -L flag ] [ -M ] [ -N [ e ][ t ][ amp ][/ sigma [/ offset ]] ] [ -S slopefile ] [ -V ] grdgradient may be used to compute the directional derivative in a given direction ( -A ), or the direction ( -S ) [and the magnitude ( -D )] of the vector gradient of the data. ... If amp is not given, default amp = 1. ...

Еще в разделе: (Показать все результаты (>310) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdfft.html
• http://xray.sai.msu.ru/~ivan/gmt/man/pswiggle.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdedit.html

. Homepage . Belozersky Institute . GeneBee . Russian EMBnet Node . ALiComp - GeneBee Alignments Comparison . Help . Advanced query . Alignment title . Picture types . Offsets comparison Column values comparison Col. values comparison 2 . First alignment ( Example ) . Second alignment ( Example ) . Last updated: August 26 2001. Comments and bug-reports send to: nik@genebee.msu.su

Еще в разделе: (Показать все результаты (>138) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank
• GeneBee Graphical Alignment - Advanced

... This plug-in enables you to add various types of lighting effects to your (RGB) image. ... Directional light . ... Well, you get the idea :) The default settings for this light-type is [-0.5,-0.5,-1.0]. ... Higher values makes your image reflect a lot of light (appear lighter or more intense), while smaller values makes it appear more dull or matte. ... A value of 1.0 makes your image very shiny (bright high-lights) while smaller values makes you image less shiny, making the high-lights dimmer. ...

Еще в разделе: (Показать все результаты (>1581) - www.sai.msu.su/ )

• The Name of the Plug-In: Example Images
• GIMP Plug-In Examples
• FTS Parser Example

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. Filter automatically determines the blockiness's strength on the frame and in the certain part of it, preserving the maximum of details. ...

Еще в разделе: (Показать все результаты (>169) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Лаборатория компьютерной графики и
• Video Frame Rate Double Up-Conversion | Graphics and Media Lab
• Video Frame Rate Double Up-Conversion | Лаборатория компьютерной графики и

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>438) - itpm.msu.su/ )

• Issues Regarding DNS and Apache - Apache HTTP Server
• Alignment, font styles, and horizontal rules in HTML documents
• Another Example

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>94) - neptun.sai.msu.ru/ )

• Issues Regarding DNS and Apache
• Apache module mod_auth
• Apache module mod_vhost_alias

... pair-cores/web: add internal link to example from alignment input field . ... pair_cores/web/approot/locales/pair-cores-web.xml pair_cores/web/approot/locales/pair-cores-web_ru.xml . ... 1.1 --- a/pair_cores/web/approot/locales/pair-cores-web.xml Mon Jan 14 19:48:26 2013 +0400 1.2 +++ b/pair_cores/web/approot/locales/pair-cores-web.xml Tue Jan 15 18:31:47 2013 +0400 1.3 @@ -1,7 +1,9 @@ 1.4 <?xml version="1.0" encoding="UTF-8"?> 1.5 <messages nplurals='2' plural="n==1 ? ...

Еще в разделе: (Показать все результаты (>30147) - kodomo.fbb.msu.ru/ )

• allpy: 21cfc7897a8f sandbox/ttk.py
• allpy: b520e79fd1f4
• allpy: b412a580e998 allpy/block.py