The QDialog class is the base class of dialog windows. ... QDialog  ( QWidget * parent=0, const char * name=0, bool modal=FALSE, WFlags f=0 )  . ... This enters a local event loop, which is terminated when the modal dialog calls done () (or accept () or reject ()). ... Calls reject () if it is a modal dialog, or accepts the close event if it is a modeless dialog. ... Shows the dialog box on the screen, as QWidget::show () and enters a local event loop if this dialog is modal (see constructor). ...

Еще в разделе: (Показать все результаты (>655) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QPopupMenu Class
• Qt Toolkit - QMenuBar Class
• Qt Toolkit - QPaintDevice Class

. This diagram shows how the precedence rules may be used to achieve the effect of hidden internal borders. The two by two table is surrounded by a solid border. The HTML table specification and style rules following the image cause the vertical border between the two cells in the first row and the horizontal border between the two cells in the first column to disappear. Return to image.

Еще в разделе: (Показать все результаты (>1956) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator

... Internal declaration of zend_module_entry . typedef struct _ zend _ module _entry zend _ module _entry; struct _ zend _ module _entry { unsigned short size; unsigned int zend _api; unsigned char zend _debug; unsigned char zts; char * name ; zend _ function _entry * functions ; int (* module _startup_func)(INIT_FUNC_ARGS); int (* module _ shutdown _func)( SHUTDOWN _FUNC_ARGS); int (*request_startup_func)(INIT_FUNC_ARGS); int (*request_ shutdown _func)( ... functions . ... module_shutdown_func . ...

Еще в разделе: (Показать все результаты (>953) - oit.cmc.msu.ru/ )

• Apache's Handler Use
• Environment Variables in Apache
• YAZ functions

... This commit also contains example of defining Markup saving mixin: markups.IntMarkupMixin and a test for it. author . ... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out )...

Еще в разделе: (Показать все результаты (>11398) - kodomo.fbb.msu.ru/ )

• allpy: 21cfc7897a8f docs/Makefile
• allpy: a514dd131bf4
• allpy: 21cfc7897a8f README.devel

What is a Handler . ... mod_actions . ... A "handler" is an internal Apache representation of the action to be performed when a file is called. Generally, files have implicit handlers, based on the file type. Normally, all files are simply served by the server, but certain file types are "handled" separately. Apache 1.1 adds the ability to use handlers explicitly. ... The following directives will enable the send-as-is handler, which is used for files which contain their own HTTP headers. ...

Еще в разделе: (Показать все результаты (>106) - neptun.sai.msu.ru/ )

• Apache Multiple Log Files
• Apache module mod_example
• Environment Variables in Apache

... Apache HTTP Server Version 2.0 . ... This document describes the use of Apache's Handlers. ... A "handler" is an internal Apache representation of the action to be performed when a file is called. Generally, files have implicit handlers, based on the file type. Normally, all files are simply served by the server, but certain file types are "handled" separately. ... The following directives will enable the send-as-is handler, which is used for files which contain their own HTTP headers. ...

Еще в разделе: (Показать все результаты (>500) - itpm.msu.su/ )

• mod_dav - Apache HTTP Server
• mod_auth_digest - Apache HTTP Server
• mod_example - Apache HTTP Server

HOME . this is the pathname of your "home" directory when you login and to which cd changes when invoked with no argument. ... defines the directories searched when the shell is looking for the file to execute when processing a command . MAIL . if set to the name of a mail file the shell will inform you of the arrival of new mail. ... contains the shell prompt string. ... is the continuation prompt when a command spans more than one line. ...

Еще в разделе: (Показать все результаты (>483) - comet.sai.msu.ru/ )

• Examples of quoting special characters
• Example of how mail is displayed
• Examples of editing previous command lines

... Example: < Include an example of the Plugin in action. ... You can release your tested, packaged Plugin to the TWiki community through the TWiki:Plugins web. ... Post the Plugin documentation topic in the TWiki:Plugins web: . ... In case the Plugin generates data just for internal use, or data which is not specific to a topic, store it in the Plugin's attachment directory. ... In case the Plugin generates data which is specific to a topic, store it in the topic's attachment directory. ...

Еще в разделе: (Показать все результаты (>40769) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (20 vs. 21) - TWiki
• TwistyContrib - TWiki - TWiki - (printable)
• TWikiTip024 - TWiki - TWiki

Network Working Group T. Taylor Request for Comments: 4735 Nortel Category: Standards Track October 2006 Example Media Types for Use in Documentation Status of This Memo This document specifies an Internet standards track protocol for the Internet community, and requests discussion and suggestions for improvements. ... Taylor Standards Track [Page 1] RFC 4735 Example Media Types October 2006 2. ... Taylor Standards Track [Page 3] RFC 4735 Example Media Types October 2006 Intended usage: LIMITED USE. ...

Еще в разделе: (Показать все результаты (>21095) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc4735.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc3849.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc3849.txt.pdf

... Wiki . ... wiki: WikiProcessors . ... Processors can be thought of as macro functions to process user-edited text . ... Besides their content, some Wiki processors can also accept parameters , which are then given as key=value pairs after the processor name, on the same line. ... Example 3 : Searching tickets from a wiki page, by keywords. {{{ #!html <form action="/query" method="get"><div> <input type="text" name="keywords" value="~" size="30"/> <input type="submit" value="Search by Keywords"/> <!-...

Еще в разделе: (Показать все результаты (>1328) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• / (log) ? Python Battle
• examples.zip тАУ Cyclyc Cell Automata

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

... About lab . ... MSU Graphics & Media Lab (Video Group) . MSU StegoVideo allows to hide any file in a video sequence before compression and extract it after decompression with unknown codec. ... Small video distortions after hiding info . It is possible to extract info after video was compressed . ... compressed frame with hidden info - information was completely recovered! Quality of information extracted from compressed video depends on codec, data redundancy and frame size. ...

Еще в разделе: (Показать все результаты (>190) - graphics.cs.msu.ru/ )

• Hide information in video | Лаборатория компьютерной графики и мультимедиа
• Removing of blocking effect from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab

... McMurtry, Mercuri, Watling - Presenting Microsoft Communication Foundation: Hands-on! ... Название: Presenting Microsoft Communication Foundation: Hands-on! Авторы: McMurtry, Mercuri, Watling . ... Microsoft Windows Communication Foundation: Hands-on addresses an unmet need in the marketplace as there are no books, or much documentation at all, of the post-Beta 1 WCF programming model. ... communication objects 2nd . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10097) - lib.mexmat.ru/ )

• Baird K.C. - Ruby by Example: Concepts and Code :: Электронная библиотека
• Onion F. - Essential ASP.NET With Examples in C# :: Электронная библиотека
• Buckland M. - Programming Game AI by Example :: Электронная библиотека

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>56) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... ucar.netcdf.AbstractNetcdf . ... public abstract class AbstractNetcdf . ... Create an empty instance to be populated with instances of some subclass of Variable. protected . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... Returns the set of dimensions associated with this, the union of those used by each of the variables. protected void . ... Returns the set of dimensions associated with this, the union of those used by each of the variables. ...

Еще в разделе: (Показать все результаты (>157) - angel.cs.msu.su/ )

• : Class ConcreteIndexMap
• : Class AbstractLogger
• DataTableModel

For relaxed scans, you should use the RUNTYP=rsurface, and use ifreez in $statpt and PC GAMESS/Firefly-specific extensions in the $surf group. ... Below is the sample for CH3-CH3 molecule. CONTRL RUNTYP=rsurface NZVAR=18 COORD=ZMT mplevl=2 $END $SYSTEM TIMLIM=500 MEMORY=30000000 $END $BASIS GBASIS=tzv ndfunc=1 $END ! To freeze coord # 12 during constrained optimization $statpt opttol=1d-5 nstep=1000 IFREEZ(1)=12 $end ! ... ENERGY COORD1 | ... 0.0048607787 2 ( 3.75000)| ... 0.0048607787 ...

Еще в разделе: (Показать все результаты (>71) - classic.chem.msu.su/ )

• Lesson 3: two methods for preparing Firefly' input files with basis sets and

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>102) - lnfm1.sai.msu.ru/ )

• Calibration data

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>6953) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>55) - imaging.cmc.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide