... Scientific research . ... The scientific and other interests of the departments staff are described on their personal pages. ... Senior Researcher . 939-10-29 . ... Leading Researcher . ... Researcher . ... Leading Engineer . ... Head of Department . ... The scientific results of space research of the Moon . Lunar craters named in honor of members of the institute . ... Our address is: . Lunar and Planetary Department . ... Head of Department Shevchenko V.V. Electronic mail address: . ...

Еще в разделе: (Показать все результаты (>110) - selena.sai.msu.ru/ )

• Mikhail V. Goryachev
• The CCD-chamber "Vega-202"
• Vadim I. Chikmachov

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>488) - oit.cmc.msu.ru/ )

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>478) - phys.msu.ru/ )

... Status of the Institute . ... The International Society for the Study of Time . ... Helping researchers to understand the diverse implicit and explicit notions of 'time' that predominate in numerous scientific disciplines . ... The upkeep, management, support, enlargement, and improvement of the institute's virtual library: "Bibliokhronos" . The upkeep, management, support, enlargement, and improvement of the institute's catalogue of publications topically concerned with time studies . ...

Еще в разделе: (Показать все результаты (>1101) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• On the Institute
• Proceedings of the Institute

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>44) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>19181) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt

... к почтовому серверу ГАИШ lnfm1.sai.msu.ru . ... WEB-страницы отделов ГАИШ . ... на LNFM1 . HERITAGE - АСТРОНОМИЧЕСКОЕ НАСЛЕДИЕ . астрономическое образование с сохранением традиций) . Лаборатория Новых Фотометрических Методов . ... Леонтьев Сергей Ефимович . ... Копаев Александр А. Отдел Радиоастрономии . Татарников Андрей М. Пахомов Юрий . ... Гусев Александр Сергеевич . ... Кононович Эдвард В. Купряков Юрий А. Горшков Алексей Б. Отдел Звездной астрофизики . ... Моисеев Алексей . ...

Еще в разделе: (Показать все результаты (>352) - lnfm1.sai.msu.ru/ )

• Bookmark

... Geography of World Economy . ... Cryolithology and Glaciology . ... Departments . ... Research laboratories . ... Field stations . ... Type of field courses . ... Department of Cryolithology and Glaciology The Department was founded in 1945 with the name Department of northern countries . ... Our students are active members of PYRN (Permafrost Young Researchers Network), in which they share best practices, information about conferences, field courses, jobs. ... ISBN 5-89176-095-9 . ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Department of Geomorphology and Paleogeography
• Department of Meteorology and Climatology
• Department of Social-Economic Geography of Foreign Countries

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>35054) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

. About the University . Application . FAQ . Electronic Resources . About the Faculty . Departments . Labs and Research Centres . Photo Archive . Please note that English & Russian versions of this site do not coinside . All rights reserved under Russian & International laws. Copyright © 1997-2011 Faculty of History, MSU. No part of this site may be reproduced electronically or otherwise without the prior written permission of the copyright owner.

Еще в разделе: (Показать все результаты (>37723) - hist.msu.ru/ )

This home page belongs to small group of scientists working at . Sternberg Astronomical Institute which is a part of Moscow State University . ... Электронная библиотека научно-технической и художественной литературы (доступна только из ГАИШ) . ... Local staff . Dr. Edward Kononovich (konon -at- sai.msu.ru), Associate Professor . ... Dr. Sergey Ayukov (asv -at- sai.msu.ru), Research Fellow, Webmaster of the group . ... Joint seminar of Solar Studies Structure Group and Solar Photometry Group . ...

Еще в разделе: (Показать все результаты (>1564) - crydee.sai.msu.ru/ )

• V.A.Baturin - Home Page at Sternberg Astronomy Institute, MSU
• ASACafedra

. Welcome to . Comet . Web server of . RadioAstronomy . Department . Sternberg Astronomical Institute . Moscow University . Questions and comments send to martis @ sai.msu.ru .

Еще в разделе: (Показать все результаты (>109) - comet.sai.msu.ru/ )

• Rudnitskij Georgij M. Home Page
• RadioAstronomy Dept of SAI Home Page
• The if statement

. Copyright Nikita's Website Inc. All Rights Reserved. E-mail . Kalinin Nikita Vadimovich About Me Contacts . Hello, you are on my home page . My name is Kalinin Nikita. I am a PhD student of Moscow State University, physics department, Chair of Polymer and Crystal Physics. My hobbies . Football, travelling, skiing, skating, English, Computer science . Research interests . Liquid crystals . Scientific adviser . Emelyanenko Alexander Vyacheslavovich .

Еще в разделе: (Показать все результаты (>501) - polly.phys.msu.ru/ )

• Main - Chair of Polymer and Crystal Physics
• Welcome to my page
• Contacts

... Senior Lecturer, Chair of General Physics, Physical Department, Moscow State University; Ph.D. Igor I. Vlasov . Senior Researcher, Center of Research in Natural Sciences, Institute of General Physics of RAS; Ph.D. Igor G. Persiantsev . ... The Nesmeyanov Institute of Organoelement Compounds of Russian Academy of Sciences. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>65) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

... Государственный Астрономический Институт имени П.К. Штернберга МГУ . ... Семинары ГАИШ . ... Государственный астрономический институт им. П.К.Штернберга (ГАИШ) научно-исследовательский институт, являющийся одним из подразделений МГУ им. М.В. Ломоносова . ... 11 декабря 2006 года исполнилось 175 лет со дня создания на Пресне Астрономической обсерватории Московского университета, ставшей впоследствии базой для формирования Государственного астрономического института им. П.К. Штернберга (ГАИШ МГУ). ...

Еще в разделе: (Показать все результаты (>123) - sai.msu.ru/ )

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow  ( QWidget * parent=0, const char * name=0, WFlags f=0 )  . QWindow  ()  . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>723) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - biff/biff.cpp example file
• Qt Toolkit - qwindowdefs.h include file
• Qt Toolkit - qlistview.h include file

... MySQL shareware license for Microsoft operating systems (Version 1, September 4, 1998) . ... This License applies when running MySQL on any Microsoft operating system. Microsoft operating systems include all versions of Microsoft Windows NT and Microsoft Windows. ... E-Mail: mysql-licensing@mysql.com For more about the license prices and commercial support, like email support, please refer to the MySQL manual. ... Our current policy is that a user with the MySQL license can get free upgrades. ...

Еще в разделе: (Показать все результаты (>543) - itpm.msu.su/ )

• Links
• MySQL Reference Manual for version 3.23.10-alpha. - J The MySQL server license
• worker - Apache HTTP Server

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>772) - kodomo.cmm.msu.ru/ )

• Term3
• Term4
• Pouliakhina's page

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>817) - acs366.phys.msu.su/ )

... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>86) - qilab.phys.msu.ru/ )