... О UNИX . ... HelpOnMacros/EmbedObject . Неизменяемая страница . ... wikiconfig.py file, under the Content options section, add the following lines: mimetypes_xss_protect = ['text/html', ' application /x-shockwave-flash', ' application /xhtml+xml',] mimetypes_embed = [' application /x-dvi', ' application /postscript', ' application /pdf', ' application /ogg', ' application /vnd.visio', ' image /x-ms-bmp', ' image /svg+xml', ' image /tiff', ' image /x-photoshop', ' audio /mpeg', ' ... image/tiff . ...

Еще в разделе: (Показать все результаты (>277) - uneex.mithril.cs.msu.su/ )

SLOT= 0 KEYWORDS= ~alpha ~amd64 ~ia64 ~ppc ~ppc64 ~sparc ~x86 IUSE= capi celt debug doc +dtmf examples fax ffmpeg h224 h281 h323 iax ilbc ipv6 ivr ixj java ldap lid + plugins sbc sip sipim +sound srtp ssl static-libs stats swig theora + video vpb vxml wav x264 x264-static xml REQUIRED_ USE = x264-static? ( x264 ) h281? ( h224 ) sip? ( sipim ) RDEPEND= = net-libs / ... use plugins || ! use sound || ! ...

Еще в разделе: (Показать все результаты (>47109) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/net-libs/opal/opal-3.10.11.ebuild
• http://mirror.msu.net/pub/gentoo-portage/net-libs/ptlib/ptlib-2.10.11.ebuild
• http://mirror.msu.net/pub/gentoo-portage/net-libs/ptlib/ptlib-2.12.9-r1.ebuild

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... To enable mod_dav , add the following to a container in your httpd.conf file: . ... In addition, a location for the DAV lock database must be specified in the global section of your httpd.conf file using the DavLockDB directive: . ... In order for mod_dav to manage files, it must be able to write to the directories and files under its control using the User and Group under which Apache is running. ...

Еще в разделе: (Показать все результаты (>2657) - uneex.lorien.cs.msu.su/ )

• mod_dumpio - Apache HTTP Server
• mod_userdir - Apache HTTP Server
• HelpOnProcessingInstructions - UNИX

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... To enable mod_dav , add the following to a container in your httpd.conf file: . ... In addition, a location for the DAV lock database must be specified in the global section of your httpd.conf file using the DavLockDB directive: . ... In order for mod_dav to manage files, it must be able to write to the directories and files under its control using the User and Group under which Apache is running. ...

Еще в разделе: (Показать все результаты (>500) - itpm.msu.su/ )

• mod_dumpio - Apache HTTP Server
• mod_userdir - Apache HTTP Server
• Per-user web directories - Apache HTTP Server

PHP Manual . ... This module uses the functions of the bzip2 library by Julian Seward to transparently read and write bzip2 (.bz2) compressed files. ... This module requires bzip2/libbzip2 version >= 1.0.x. This example opens a temporary file and writes a test string to it, then prints out the contents of the file. ... bzclose -- Close a bzip2 file pointer . ... bzerrno -- Returns a bzip2 error number . bzerror -- Returns the bzip2 error number and error string in an array . ... bzclose ...

Еще в разделе: (Показать все результаты (>908) - oit.cmc.msu.ru/ )

• PHP's Automatic Build System
• udm_set_agent_param
• Zip File Functions (Read Only Access)

... You can search for topics with specific form data using the %SEARCH% variable - see TWikiVariables . Changed: . ... This is a more general replacement for the TWikiCategoryTable capability, in particular Forms are defined by special topics, where as categories were defineind using special templates. ... Field Type: The type of a field when editing a form. ... Values of fields that have more then one value, e.g. of type radio, select and checkbox can be defined by field value template topics . ...

Еще в разделе: (Показать все результаты (>44169) - dualopt1.cmm.msu.ru/ )

• TWikiPreferencesForm - TWiki - TWiki - (printable)
• SlideShowPlugin - TWiki - TWiki - (printable)
• CommentPluginTemplateExample - Sandbox - TWiki

To get an overview of section 1 (one) of the manual: man 1 intro . ... This displays a one line synopsis of each command that has this keyword in its description. To search the online manual for a command with the phrase "copy files": man -k 'copy files' . ... To check what a command does: whatis more more, page (1) - browse or page through a text file . ... To display the manual page for the cp (copy files) command: man cp . ... To print the manual page for the man command: man -t man . ...

Еще в разделе: (Показать все результаты (>492) - comet.sai.msu.ru/ )

• Examples of using the cd command
• Searching by keyword
• Logging in using telnet

This module provides for user-specific directories. ... Source File: mod_userdir.c . ... Module: mod_userdir . ... Use of the enabled keyword, or disabled with a list of usernames, is only available in Apache 1.3 and above. ... Directory-filename is one of the following: . ... A request for http://www.foo.com/~bob/one/two.html will be translated to: UserDir public_html -> ~bob/public_html/one/two.html UserDir /usr/web -> /usr/web/bob/one/two.html UserDir /home/*/www -> /home/bob/www/one/two.html . ...

Еще в разделе: (Показать все результаты (>108) - neptun.sai.msu.ru/ )

• Apache module mod_negotiation
• Apache module mod_example
• Apache module mod_auth

The QPushButton widget provides a push button with a text or pixmap label. ... QPushButton  ( QWidget * parent=0, const char * name=0 )  . QPushButton  ( const char * text, QWidget * parent=0, const char * name=0 )  . void  setToggleButton  ( bool )  . ... A default push button in a dialog emits the clicked signal if the user presses the Enter key. ... See also: QRadioButton , QToolButton and GUI Design Handbook: Push Button . ... Only one push button in the dialog can be default. ...

Еще в разделе: (Показать все результаты (>621) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_example
• Qt Toolkit - QSlider Class
• Qt Toolkit - QMainWindow Class

... Wiki . ... wiki: WikiProcessors . ... Processors can be thought of as macro functions to process user-edited text . ... Besides their content, some Wiki processors can also accept parameters , which are then given as key=value pairs after the processor name, on the same line. ... Example 3 : Searching tickets from a wiki page, by keywords. {{{ #!html <form action="/query" method="get"><div> <input type="text" name="keywords" value="~" size="30"/> <input type="submit" value="Search by Keywords"/> <!-...

Еще в разделе: (Показать все результаты (>2118) - kodomo.cmm.msu.ru/ )

• TracNotification тАУ Tanchiki
• TracNavigation (diff) тАУ Tanchiki
• TracCgi тАУ Tanchiki

Routines can now be called with keyword arguments and can use default arguments, that means that some arguments can be given with keywords instead of position and some do not have to be given at all, in which case a standard or default value is used. ... IMPLICIT NONE INTERFACE SUBROUTINE SOLVE (A, B, N) INTEGER, INTENT (IN) : : N REAL, INTENT(OUT) : : A REAL, INTENT(IN), OPTIONAL : : B END SUBROUTINE SOLVE END INTERFACE REAL X ! ... You will use keyword arguments and default arguments so that . ...

Еще в разделе: (Показать все результаты (>1121) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• Long description for example showing how structurally overlapping cells are
• One example

... The dynamic map of a chromatographic system as a tool to study time-dependent processes in the high-performance liquid chromatography" . Prudkovskiy A.G. An algorithm for the visualization of time-dependent processes in the high-performance liquid chromatography is proposed as a dynamic map of a chromatography system. ... Keywords: high-performance gradient chromatography, mathematical modeling, chromatographic retention map . ...

Еще в разделе: (Показать все результаты (>555) - num-meth.srcc.msu.ru/ )

• "Enabling science through emerging HPC technologies: accelerating numerical
• "Generation of octree meshes with cut cells in multiple material domains"
• "A practical approach to the interaction between a computing cluster monitoring

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>3) - ocl.sai.msu.ru/ )

CDFE => Online Services => NSR Search Engine Description . This program lets to find articles from Nuclear Science References (NSR). I. Names and descriptions of NSR Search Engine fields . ... Quantity Type Parameter type of <SELECTRS>. ... Target nucleus Chemical symbol or charge and atomic number of target nucleus. ... Range of energy Range of reaction energy (Example: 0.3 - 1 GeV ). ... Example: 1998) . ... Work scheme NSR Search Engine. ... NSR Search Engine printscreen for example. ...

Еще в разделе: (Показать все результаты (>23) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>66) - scon155.phys.msu.su/ )

... fc3:dokuwiki:example ]] . THEP . ... Show page . ... Media Files . ... 17/122007 15:37 . ... 14/072005 19:05 . 1.3 MB . ... fc3/dokuwiki/example.txt ۤ Last modified: 15/072005 12:05 (external edit) . Show page Old revisions . Media Manager Back to top . ...

Еще в разделе: (Показать все результаты (>1737) - theory.sinp.msu.ru/ )

• Checking the correctness of the model
• [RU-NGI] dcache checksums enable
• Example: Summation of diagrams and symbolic integration by means of the Reduce

Электронная библиотека Попечительского совета . ... Kalantar-Zadeh K., Fry B. - Nanotechnology-Enabled Sensors . ... Название: Nanotechnology-Enabled Sensors . Авторы: Kalantar-Zadeh K., Fry B. Аннотация: . ... Nanotechnology-Enabled Sensors are devices which operate more efficiently, are more sensitive and selective, respond faster, and can be fabricated with lower cost than conventional sensors. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11878) - lib.mexmat.ru/ )

• Nilsson J. - Applying Domain-Driven Design and Patterns: With Examples in C#
• Albing C., Vossen JP, Newham C. - bash Cookbook: Solutions and Examples for
• Doukhan P. - Mixing. Properties and examples :: Электронная библиотека

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• XAFS Publication Database search form
• Best search engines for finding scientific information in the Internet:

... use of several physical disks to run each PC GAMESS/Firefly process so that each copy uses only its own HDD. ... The LAM/MPI version 7.1.X. Note that the PC GAMESS/Firefly is not compatible with older LAM/MPI versions e.g., 6.5.9. ... Please consult with the LAM/MPI documentation and manual pages before start experimenting with parallel PC GAMESS/Firefly runs. The LAM/MPI-linked PC GAMESS/Firefly binaries should present on all the computers you plan to run the PC GAMESS/Firefly in parallel . ...

Еще в разделе: (Показать все результаты (>87) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - Cube files
• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• PC GAMESS/Firefly DOCUMENTATION - running in parallel Linux/MPICH binaries

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )