... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>2686) - uneex.lorien.cs.msu.su/ )

• mod_example - Apache HTTP Server
• HelpOnMoinCommand/ExportDump - UNИX
• Building Packages: A Simple Example

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>417) - itpm.msu.su/ )

• Another Example
• Examples
• An Example sendmail.m4 File

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>91) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use

This module is contained in the modules/mod_example.c file, and is not compiled in by default. It illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... cp src/modules/example/* src/modules/ mymodule . ... Example . ...

Еще в разделе: (Показать все результаты (>557) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - trivial/trivial.cpp example file
• Qt Toolkit - progress/progress.cpp example file
• Running the example

... О UNИX . ... ExportDump . ... Example with --page parameter using regular expression . Output . ... Known limitations "moin export dump" is an HTML export utility to create static HTML dumps of wiki content. ... The --page parameter is optional and will dump pages matching the pagename. ... With the parameter, the output is limited by ACL rules to pages that can be read by the username. ... Note the --page , --target-dir , and --username parameters must follow the export dump parameters. ...

Еще в разделе: (Показать все результаты (>679) - uneex.mithril.cs.msu.su/ )

• HelpOnSlideShows - UNИX
• HelpOnMacros/EmbedObject - UNИX
• HelpOnLists - UNИX

This example shows a difference between CSS's table model for HTML and for other document formats. The first, HTML, example is defined by HTML to be illegal, as it would lead to overlapping cells if HTML's rules for layout are followed. ... The diagram depicts how the two examples, the HTML one and the almost identical non-HTML one, might be rendered. ... The rendering of the non-HTML example is on the right, it follows the CSS rules and thus has no overlapping cells. ...

Еще в разделе: (Показать все результаты (>655) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• One example
• Long description for the first Bach/XML formatting example

. Электронная библиотека . механико-математического факультета . Московского государственного университета . Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . Мехматянам . Первый курс . Второй курс . Третий курс . Четвертый курс . Пятый курс . Поиск по указателям . Журнал Probability and Statistics by Example . 1. Probability and statistics by example (?1 2005) . Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . | | О проекте

Еще в разделе: (Показать все результаты (>6807) - lib.mexmat.ru/ )

• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная
• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Поиск книг, содержащих Counter example :: Электронная библиотека

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>48) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

To print commands and their arguments as they are executed: cat example #!/bin/sh TEST1=result1 TEST2=result2 if [ $TEST1 = "result2" ] then echo $TEST1 fi if [ $TEST1 = "result1" ] then echo $TEST1 fi if [ $test3 = "whosit" ] then echo fail here cos it's wrong fi . This is a script called example which has an error in it; the variable $test3 is not set so the 3rd and last test [ command will fail. Running the script produces: example result1 [: argument expected . ...

Еще в разделе: (Показать все результаты (>468) - comet.sai.msu.ru/ )

• Examples of using the diff command
• Examples of using the sort command
• Example of how mail is displayed

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>4) - storage.bioinf.fbb.msu.ru/ )

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>691) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1164) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

This plugin converts a topic with headings into a slideshow. ... How to Create Your own Slide Template . ... There is already a defacto standard for presentations, why this plugin? This plugin makes sense for organizations that do already have lots of content in TWiki: It is easy to create a web based presentation that contains many links to related content. ... Normal topic view mode: Headings and text is shown in the usual TWiki rendering, representing the outline of the slideshow. ...

Еще в разделе: (Показать все результаты (>39769) - dualopt1.cmm.msu.ru/ )

• IncludeTopicsAndWebPages - TWiki - TWiki
• IncludeTopicsAndWebPages - TWiki - TWiki - (printable)
• %TOPICTITLE% (5 vs. 6) - TWiki

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>5580) - kodomo.fbb.msu.ru/ )

• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea state.py
• cca: a308291203ea .hgtags

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>34) - hist.msu.ru/ )

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>51) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>146) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round