To send a single file from your current directory on the local host to the current directory on the remote host: ftp> send afile . This copies the file afile from your current directory on the local host to your current directory on the remote host. ... This copies the contents of the file april in the sub-directory REPORTS , which is in your current directory on the local host to the file month4 in the sub-directory reports , which is in your login directory on the remote host. ...

Еще в разделе: (Показать все результаты (>603) - comet.sai.msu.ru/ )

• Examples of getting files with the ftp program
• Pathnames

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . rotatelogs is a simple program for use in conjunction with Apache's piped logfile feature. ... CustomLog "|bin/rotatelogs /var/logs/logfile 86400" common . This creates the files /var/logs/logfile.nnnn where nnnn is the system time at which the log nominally starts (this time will always be a multiple of the rotation time, so you can synchronize cron scripts with it). ... time (localized) . ...

Еще в разделе: (Показать все результаты (>437) - uneex.lorien.cs.msu.su/ )

• mod_vhost_alias - Apache HTTP Server
• mod_ext_filter - Apache HTTP Server
• mod_file_cache - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... rotatelogs is a simple program for use in conjunction with Apache's piped logfile feature. ... CustomLog "|bin/rotatelogs /var/logs/logfile 86400" common . This creates the files /var/logs/logfile.nnnn where nnnn is the system time at which the log nominally starts (this time will always be a multiple of the rotation time, so you can synchronize cron scripts with it). ... time (localized) . ...

Еще в разделе: (Показать все результаты (>706) - itpm.msu.su/ )

• mod_vhost_alias - Apache HTTP Server
• Defining the Local Mailer
• mod_ext_filter - Apache HTTP Server

This module provides support for dynamically configured mass virtual hosting . ... Source File: mod_vhost_alias.c . ... For simple name-based virtual hosts you might use the following directives in your server configuration file: UseCanonicalName Off VirtualDocumentRoot /usr/local/apache/vhosts/%0 . A request for http://www.example.com/directory/file.html will be satisfied by the file /usr/local/apache/vhosts/www.example.com/directory/file.html . ... Module: mod_vhost_alias . ...

Еще в разделе: (Показать все результаты (>127) - neptun.sai.msu.ru/ )

• Apache HTTP Server: Security Tips
• Manual Page: httpd - Apache HTTP Server

Some hints and tips on security issues in setting up a web server. ... In typical operation, Apache is started by the root user, and it switches to the user defined by the User directive to serve hits. ... For example, if you choose to place ServerRoot in /usr/local/apache then it is suggested that you create that directory as root, with commands like these: mkdir /usr/local/apache cd /usr/local/apache mkdir bin conf logs chown 0 . ... Allow from all . ... Accessing http://localhost/~root/ . ...

Еще в разделе: (Показать все результаты (>986) - oit.cmc.msu.ru/ )

• The Apache TPF Port
• Variable scope
• Environment Variables in Apache

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes

... calg:archive07 ]] . THEP . ... archive07 . ... Computing in THEP (FAQ) . ... Grobner bases and related methods, 2006 . ... Specialization of functional programs by supercompilation . ... Wednesday, December 19, at 16.20 in 780 room of building VMK, Moscow State University. ... The simplest task of program specialization is to construct another program q_p(y) such that q_p(y) = p(x_0, y) on the domain of the program p and the program q_p(y) is more optimal than the p (with respect to run-time). ...

Еще в разделе: (Показать все результаты (>1951) - theory.sinp.msu.ru/ )

• QFTHEP'97 Workshop
• QFTHEP'2000- information bulletin #1
• QFTHEP'2004 - information bulletin #1

Here are some of the example programs that are included with Qt: . aclock/aclock.cpp . application/application.cpp . ... mainlyMotif/editor.cpp . mainlyQt/editor.cpp . mainlyXt/editor.cpp . ... These paths are relative to the examples subdirectory in the Qt distribution. ... Copyright © 1998 Troll Tech . ... Qt version 1.40 ...

Еще в разделе: (Показать все результаты (>760) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - biff/biff.cpp example file
• Qt Toolkit - dirview/dirview.cpp example file
• Qt Toolkit - life/life.cpp example file

... FILESDIR}"/${PN}-0.33-dont-check-iptables.patch # Move files away from /lib/ufw. ... /null || die else _EMPTY_LOCALE_LIST= no fi distutils-r1_python_prepare_all } python_install_all() { newconfd ${ FILESDIR } / ufw .confd ufw newinitd ${ FILESDIR } / ufw -2.initd ufw systemd_dounit ${ FILESDIR }/ ufw .service exeinto / usr /share/${PN} doexe tests/check-requirements # users normally would want it insinto / usr /share/doc/${PF}/logging/syslog-ng doins ${ ...

Еще в разделе: (Показать все результаты (>27245) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/net-firewall/ufw/ufw-0.34_pre805-r2.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc42.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc42.txt.pdf

Next: A wavelet Up: No Title Previous: Introduction . Figure: Data characterization using wavelets. The time axis is common to the raw data and the wavelet map (background), for which the vertical axis is analogous to an inverse frequency (Section 10). The Mexican hat wavelet (Section 3) used for the background wavelet map (Section 5) measures the magnitudes of local maxima (blue-grey shades) and minima (yellow/red shades) as a function of time and duration. ...

Еще в разделе: (Показать все результаты (>2402) - crydee.sai.msu.ru/ )

• Feature enhancement: local maxima
• Use of program libraries
• Program units

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>32) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

... find changesets by author, revision, files, or words in the commit message . ... author . ... 3 say () { echo "$@" >&2; } . ... 6 local newPYTHONPATH . ... 0" && return 1 . ... 12 [[ "$PYTHONPATH" = "$newPYTHONPATH" ]] && say "Already done" && return . 13 [[ -n "$PYTHONPATH" ]] && say "PYTHONPATH was not empty" && return . ... 15 export PYTHONPATH = "$newPYTHONPATH" . 16 export PATH = "$newPYTHONPATH/utils:$PATH" . ... 18 echo "PYTHONPATH=$PYTHONPATH" . 19 echo "PATH=$PATH" . ...

Еще в разделе: (Показать все результаты (>14976) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 allpy/util.py
• allpy: log
• allpy: b520e79fd1f4 debian/changelog

... About lab . ... Selected publications . Publications . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Interactive Local Transfer Between Images . Publication Type . Conference Paper . Year of Publication . ... Conference Name . ... Publication Language . ... http://graphics.cs.msu.ru/en/publications/text/gc2007mv.pdf . ...

Еще в разделе: (Показать все результаты (>841) - graphics.cs.msu.ru/ )

• Method For Localization Of Human Faces In Color-Based Face Detectors And
• Smart removal of blocking effects from video | Graphics and Media Lab
• Hide information in video | Graphics and Media Lab

... Cheshire S., Steinberg D.H. - Zero Configuration Networking: The Definitive Guide . ... Название: Zero Configuration Networking: The Definitive Guide . Авторы: Cheshire S., Steinberg D.H. Аннотация: . ... Zero Configuration Networking: The Definitive Guide walks you through this groundbreaking network technology, with a complete description of the protocols and ways to implement network-aware applications and devices. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12276) - lib.mexmat.ru/ )

• Pang J. - A B-differentiable equation-based, globally and locally quadratically
• Поиск книг, содержащих Local minimum :: Электронная библиотека попечительского
• Поиск книг, содержащих Local maximum :: Электронная библиотека попечительского

... TWikiVariables . ... Using Variables . Preferences Variables . ... TWikiVariables are text strings - %VARIABLE% or %VARIABLE{ parameter="value" }% - that expand into content whenever a topic is rendered for viewing. ... Preferences variables: Can be defined and changed by the user . ... type %T% to get (a preferences variable) . type %TOPIC% to get TWikiVariables (a predefined variable) . ... Type %ALLVARIABLES% to get a full listing of all variables defined for a particular topic . ...

Еще в разделе: (Показать все результаты (>40926) - dualopt1.cmm.msu.ru/ )

• NatSearch - TWiki - TWiki - (printable)
• NatSearch - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>140) - sp.cs.msu.ru/ )

• C-DVM language description
• Lib-DVM. Interface description
• Fortran DVM - Language for Portable Parallel Programs Development

INFORMATION BULLETIN No.1 . ... XXI International Workshop . on High Energy Physics and Quantum Field Theory . Repino, Saint Petersburg Area, Russia, . ... Organizers: D.V. Skobeltsyn Institute of Nuclear Physics, . M.V. Lomonosov Moscow State University and . Faculty of Physics, Saint Petersburg State University . ... J. Ellis (CERN, Geneva) . ... All further correspondence concerning the Workshop should be addressed to the Secretaries of the Workshop by e-mail and/or fax: . ...

Еще в разделе: (Показать все результаты (>133) - qfthep.sinp.msu.ru/ )

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>6955) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• LCore