... Modeling of separated flow in the inlet of a circular suction channel" . ... Methods for the mathematical modeling of separated flows in the inlet of a suction channel are discussed on the basis of the discrete vortex peculiarities of circular and polygonal shapes. ... Keywords: separated flows, discrete vortices, flows near a suction channel . PDF (in Russian) (541KB) . PDF. zip (in Russian) (465KB) . ...

Еще в разделе: (Показать все результаты (>539) - num-meth.srcc.msu.ru/ )

... Investigations in the field of higher fullerenes . Abstract Halogenation of higher fullerene mixtures or their perfluoroalkylation with R F I followed by HPLC separation of R F derivatives and subsequent synchrotron X-ray crystallographic study allowed one to confirm cage connectivities of higher fullerenes and, in addition, to receive information concerning their reactivity in radical addition reactions. ... Moscow University Chemistry Bulletin . 2009, Vol. ... Copyright (C) Chemistry Dept., ...

Еще в разделе: (Показать все результаты (>1627) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 51 (2004)
• Moscow University Chemistry Bulletin Vol. 53, No. 6, P. 369 (2012)
• Moscow University Chemistry Bulletin Vol. 53, No. 4, P. 257 (2012)

Archery simulation: Error estimation and comparison of numerical and experimental results / A. A. Luzhin. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. 2009. ... The method proposed by the author and A.V. Zvyagin for the archery problem is verified. The method is briefly discussed. ... The numerical results are compared with experimental data. ...

Еще в разделе: (Показать все результаты (>556) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

... The most precisely determined characteristic for accreting neutron stars (NS's) is their period. ... Period changes show fluctuations. ... Some applications of stochastic processes in astrophysics especially in accreting systems were discussed in Lipunov (1987),Hoshino Takeshima (1993) and Lipunov (1992).In Hoshino Takeshima (1993) the authors, using simple models of MHD turbulence, try to explain aperiodic changes in X-ray luminosity of X-ray pulsars. ... Here, -constant angular momentum. ...

Еще в разделе: (Показать все результаты (>446) - xray.sai.msu.ru/ )

• Frequency distribution of galactic binaries

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>363) - rtm-cs.sinp.msu.ru/ )

• Activation Mode Library

Электронная библиотека Попечительского совета . ... Lewis M. - Comparing, Designing, and Deploying VPHs . ... Название: Comparing, Designing, and Deploying VPHs . Автор: Lewis M. Аннотация: . ... Comparing, Designing, and Deploying VPNs will bring together many of the most popular VPN technologies for convenient reference. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10649) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement
• Поиск книг, содержащих Implicit separated boundary conditions :: Электронная
• Svarovsky L. - Solid-Liquid Separation :: Электронная библиотека

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>257) - www.philol.msu.ru/ )

PHP Manual . ... int dbx_compare ( array row_a, array row_b, string columnname_or_index [, int flags]) . ... This function is EXPERIMENTAL . ... Returns 0 if row_a[$columnname_or_index] is equal to row_b[$columnname_or_index], 1 if it is greater and -1 if it is smaller (or vice versa if the DBX_CMP_DESC flag is set). The flags can be set to specify comparison direction (whether sorting is ascending or descending) and comparison type (force string or numeric compare by converting the data). ...

Еще в разделе: (Показать все результаты (>724) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>169) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>112) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command

... Shortly after its discovery it was determined to be in a highly elliptical path near Jupiter and on a collision course. ... The size and mass of the original body and the individual fragments is as of this writing still highly uncertain. ... Between 16 July 1994 and 22 July 1994 the fragments impacted the upper atmosphere of Jupiter. ... The pictures were posted to the Net within hours of the impacts and caused severe overloading on some ftp and WWW sites. ... JPL's SL9 page . ... Small Bodies .. ...

Еще в разделе: (Показать все результаты (>4960) - www.sai.msu.su/ )

• SAL- Programming - Languages Compilers - Objective Caml (OCaml)
• APOD: 2011 February 3 - Six Worlds for Kepler-11
• APOD: 2007 August 20 - Cluster Crash Illuminates Dark Matter Conundrum

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...