... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2005 July 13 . Analemma of the Moon . ... So, if you photograph the Moon 51 minutes later on successive days, over one lunation or lunar month it will trace out an analemma-like curve as the actual position of the Moon wanders compared to the average -- due to the Moon's tilted and elliptical orbit. ... About APOD | ...

Еще в разделе: (Показать все результаты (>8557) - www.sai.msu.su/ )

• APOD Index - Galaxies: Clusters of Galaxies
• SAL- Other Scientific Fields - Physics Astronomy - XFITSview
• APOD: 2003 March 30 - Beijing Ancient Observatory

... So, if you photograph the Moon 51 minutes later on successive days, over one lunation or lunar month it will trace out an analemma-like curve as the actual position of the Moon wanders compared to the average -- due to the Moon's tilted and elliptical orbit. ... The southernmost Full Moon rises at the lower right above the Organ Mountains in southern New Mexico, USA, with the New Moon phase at the upper left. ... Publications with keywords: analemma - Moon - lunation - phase - full moon - new moon ....

Еще в разделе: (Показать все результаты (>72507) - www.astronet.ru/ )

• Астронет > Analemma of the Moon
• Thousands of Coma Cluster Galaxies
• Journal "Peremennye Zvezdy"

This diagram illustrates the effects of absolutely positioning a box with respect to the initial containing block. ... Most of the "inner" box contents are therefore rendered outside the document window. ... The text that is to the left of the line numbers lies outside the initial containing block. The lines, as they appear in the image, contain approximately: 1 Beginning of body contents. Start 2 of outer contents. End of outer 3 contents. End of body contents. ...

Еще в разделе: (Показать все результаты (>2030) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for example illustrating positioning with respect to a

NonPEST : a nonparametric method for Transcription Start Site prediction Tatiana Tatarinova, Laboratory of Applied Pharmacokinetics, University of Southern California , Los Angeles, USA, Tatiana.tatarinova@lapk.org Alyona Chubatiuk Department of Mathematics, University of Southern California , Los Angeles, California , USA , achubatiu@usc.edu Michael Neely Laboratory of Applied Pharmacokinetics, University of Southern ... NonPEST was able to predict positions of TSS for 13,208 loci. ...

Еще в разделе: (Показать все результаты (>245) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/244.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/125.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>733) - monkey.belozersky.msu.ru/ )

• About this project

Introduction to Gymnosperms Group of seed bearing plants that contain conifers, cycads, Ginkgo, and Gnetales. ... The 5 main lineages separated from each other during the late Carboniferous to late Triassic (311-212 mya) While many species such as Ginkgo biloba are living fossils,due to pulses of extinction and specialization most living gymnosperm species are much younger then though to be. ... Due to these climate changes older lineages of gymnosperms are mostly found in the southern hemisphere. ...

Еще в разделе: (Показать все результаты (>218) - herba.msu.ru/ )

S .. ... SNP regions in the dataset are 21bp fragments of the genome containing SNP in the middle position . ... Word frequencies in SNP regions of the human genome (zip file, 66 MB) . ... Word frequencies in SNP regions of the human genome (xls file, 1.2 MB) . The file contains the frequency of each word of length 1, 2, 3, 4 or 5 in flanks of SNP regions for several criteria of SNP selection. These frequencies are compared to the frequencies of the same words in the complete human genome . ...

Еще в разделе: (Показать все результаты (>6) - mouse.genebee.msu.ru/ )

... 6 import sequence . ... 22 * self.positions -- list of positions of the alignment.body that . ... 25 Don't change self.sequences -- it may be a link to other block.sequences . ... 34 def __init__ ( self , alignment , sequences = None , positions = None ): . ... 44 self . ... 75 If more than one pdb chain for some sequence provided, consider all of them . ... 129 alignment_sequence = self . ... 130 return ( alignment_sequence [ i ] for i in self . ... 132 def ca_atoms ( self , sequence , pdb_chain ):...

Еще в разделе: (Показать все результаты (>13134) - kodomo.fbb.msu.ru/ )

• allpy: 73070c394dc4 allpy/markup.py
• allpy: 523a681bb4e7 test/usecase2.py
• allpy: 08494fb2c47a lib/block.py

... We have compared visualized fields of GSC and USNO A1.0 catalog with unpublished photographic finding charts that were sent by L. Plaut to the compilers of the GCVS. ... 7-15 A9 --- GCVS GCVS or NSV name 17-25 F9.4 --- GSC GSC number 26 A1 --- NoteFlag *Nonstar (GSC) flag 28-29 I2 h RA2000GSC.h Hours RA (GSC), equinox 2000.0 31-32 I2 min RA2000GSC.m Minutes RA (GSC), equinox 2000.0 34-38 F5.2 s RA2000GSC.s Seconds RA (GSC), equinox 2000.0 40 A1 --- DE2000GSC.- ... Plaut, L., 1966, Bull. ...

Еще в разделе: (Показать все результаты (>85) - sai.msu.ru/ )

Mustela . On a taxonomic position of the weasel (Carnivora, Mustela ) from the Cheju Island (South Korea) . ... The weasel from Cheju Island (formerly в?' Quelpart Island), which is situated in Korean Strait south of the coast of South Korea, was described as a separate species Lutreola quelpartis Thomas, 1908. ... Abramov A.V. 2000b. The taxonomic status of the Japanese weasel, Mustela itatsi (Carnivora, Mustelidae) // Zoologicheskii Zhurnal. ... A Pictorial Guide to the Mammals of Japan. ...

Еще в разделе: (Показать все результаты (>1124) - zmmu.msu.ru/ )

... This page is a reference for all CSS classes used in PatternSkin . ... All templates that are not the view template have the body class name "patternNoViewPage". ... Search results .patternSearchResults - container on rename pages (no longer used on actual search results 'view' pages) .patternSearchResultsHeader - horizontal bar with the web color .patternSearchResults - block of one result .patternSearchResultCount - the number of results .patternSearched - feedback on the string used to search . ...

Еще в разделе: (Показать все результаты (>35969) - dualopt1.cmm.msu.ru/ )

• PatternSkinCss - TWiki - TWiki - (printable)
• %TOPICTITLE% (3 vs. 4) - TWiki
• Simple calendar setup [flat calendar]

... Investigations of the electrical properties of PbSnTeS, PbSnTeSe, and PbSnSeS solid solutions confirmed an earlier hypothesis that the positions of the tin atoms were off-center and that the tunnel motion of these atoms were suppressed in the anion sublattice. ... Other works on off-center impurities ...

Еще в разделе: (Показать все результаты (>65) - scon155.phys.msu.su/ )

This page is a reference for all CSS classes used in PatternSkin . ... Left bar: . ... Search results .patternSearchResults - container on rename pages (no longer used on actual search results 'view' pages) .patternSearchResultsHeader - horizontal bar with the web color .patternSearchResults - block of one result .patternSearchResultCount - the number of results .patternSearched - feedback on the string used to search . ... This topic: System > Skins > PatternSkin > PatternSkinCss . ...

Еще в разделе: (Показать все результаты (>6127) - wiki.cmc.msu.ru/ )

• (compare) WebHome < Main < Foswiki
• (compare) RootCA < Main < Foswiki
• (compare) NetRules < Main < Foswiki

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>127) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services

<?xml version="1.0"?> <!DOCTYPE fontconfig SYSTEM "fonts.dtd"> <fontconfig> <!-- Telugu (te) --> <match target="font"> <test name="lang" compare="contains"> <string>te</string> </test> <alias> <family>sans-serif</family> <prefer> <family>Pothana2000</family> </prefer> </alias> </match> <match target="font"> <test name="lang" compare="contains"> <string>te</string> </test> <alias> <family>serif</family> <prefer> <family>Vemana</family> </prefer> </alias> </match> <!-- Telugu (te) ends --> </fontconfig>

Еще в разделе: (Показать все результаты (>16793) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-ml/ppx_compare/
• Index of /pub/gentoo-portage/dev-perl/Struct-Compare/
• Index of /pub/gentoo-portage/dev-perl/Array-Compare/

... December 13, 1997 . The Coma Cluster of Galaxies . ... The Coma Cluster of Galaxies pictured is one of the densest clusters known - it contains thousands of galaxies . Each of these galaxies house billions of stars - just as our own Milky Way Galaxy does. ... In fact, the Coma Cluster is so big it takes light millions of years just to go from one side to the other! Most galaxies in Coma and other clusters are ellipticals , while most galaxies outside of clusters are spirals . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: June 9, 1999 - NGC 4414: A Telling Spiral
• APOD: October 18, 1999 - NGC 3603: An Active Star Cluster
• APOD: 2000 January 3 - Cas A Supernova Remnant in X Rays

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• SDPpred
• SDPlight
• SDPsite - PF07978

PHP Manual . ... PHP 4 >= 4.0.2) ldap_compare -- Compare value of attribute found in entry specified with DN . int ldap_compare ( int link_identifier, string dn, string attribute, string value) . ... Returns -1 on error. ldap_compare() is used to compare value of attribute to value of same attribute in LDAP directory entry specified with dn . The following example demonstrates how to check whether or not given password matches the one defined in DN specified entry. Example 1. ...

Еще в разделе: (Показать все результаты (>590) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• dbx_compare

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: tax of goods compared that Luxus. times. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4549) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Best Prices
• Экологический Форум - Фундаментальная Экология: Price Compare Website
• Экологический Форум - Фундаментальная Экология: compare administrative billion

... In the [H3]DAGO and [H3]DSLET binding assays the analogue I showed almost the same affinity for m -receptor and the lower affinity for d -sites compared to the parent DADLE, while the analogue II retained affinity and preference for m -receptor. Moscow University Chemistry Bulletin . 2001, Vol. ... 4, P. 287 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>601) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 53, No. 6, P. 369 (2012)
• Moscow University Chemistry Bulletin Vol. 47, No. 5, P. 353 (2006)
• Moscow University Chemistry Bulletin Vol. 44, No. 3, P. 208 (2003)