Astronomy Picture of the Day . The Large and Small of M87 . ... 16.02.1999 . ... Recent images from the Very Large Array (VLA) of radio telescopes indicate that huge bubbles of hot gas not only exist but are still being created. ... The source creating and feeding the bubbles has been traced to jets pointing back to M87's center , where a supermassive black hole is thought to live. ... Publications with keywords: M87 - radio - jet - M8 . Publications with words: M87 - radio - jet - M8 . ...

Еще в разделе: (Показать все результаты (>43288) - www.astronet.ru/ )

• Neighboring Galaxy: The Large Magellanic Cloud
• The Large Cloud Of Magellan (LMC)
• Dwarf Elliptical Galaxy M32

... 2008 November 27 . Galaxies in the River . ... Explanation: Large galaxies grow by eating small ones. ... Located over 50 million light years away, the large, distorted spiral NGC 1532 is seen locked in a gravitational struggle with dwarf galaxy NGC 1531, a struggle the smaller galaxy will eventually lose . ... The NGC 1532/1531 pair is thought to be similar to the system of face-on spiral and small companion known as M51, the Whirlpool Galaxy . ... About APOD | ...

Еще в разделе: (Показать все результаты (>9304) - www.sai.msu.su/ )

• APOD: 2001 August 4 - Neighboring Galaxy: The Large Magellanic Cloud
• APOD: 2015 August 9 - HCG 87: A Small Group of Galaxies
• APOD Index - Galaxies: Local Group

... November 9, 1999 . Spiral Galaxies in Collision . ... the Hubble Heritage Team ( AURA / STScI / NASA ) . ... Until then, spiral galaxies NGC 2207 and IC 2163 will slowly pull each other apart, creating tides of matter, sheets of shocked gas , lanes of dark dust , bursts of star formation , and streams of cast-away stars . Astronomers predict that NGC 2207, the larger galaxy on the left, will eventually incorporate IC 2163, the smaller galaxy on the right. ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: January 6, 1996 - Dwarf Elliptical Galaxy M32
• APOD: August 7, 1998 - M65 Without Moth
• APOD: 2000 October 23 - Dwarf Elliptical Galaxy NGC 205 in the Local Group

... Natalya V. Raguzova and Sergei B. Popov . ... We present a compilative catalogue of Be/X-ray binaries and candidates in the Galaxy and in the Large and Small Magellanic Clouds. This catalogue contains 160 sources and provides information on names and spectral types of optical components, distances, on spin characteristics of neutron stars, and on orbital and X-ray properties of binary systems. ... Be/X-Ray Binaries and candidates in the Galaxy . Galactic sources: comments to the Table 1 . ...

Еще в разделе: (Показать все результаты (>678) - xray.sai.msu.ru/ )

• The catalogue
• Massive X-ray Binaries
• Seminars

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>215) - biochem.bio.msu.ru/ )

• Structure and properties of G84R and L99M mutants of human small heat shock
• The role of intrinsically disordered regions in the structure and functioning

D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale magnetic fields in spiral galaxies: evolution and reversals, Astron. Astrophys., 537, A68, 13 pages (2012) . ... The effects of star-forming regions in galaxies need to be included when modelling the evolution of their magnetic fields, which can then be compared to future radio polarization observations. ... The injection of turbulent fields generates small-scale field structures. ...

Еще в разделе: (Показать все результаты (>95) - srcc.msu.ru/ )

• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of

Projects . ... SmpB . During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>49676) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• SmpB - Projects - TWiki - (printable)
• %TOPICTITLE% (search) - TWiki

... Day-by-day lines contain complete set and intended for those who have been there (I mean, in Kyoto :) . ... Large format is mainly for 1600x1200 screens and fast link (pictures are up to 150K in size). Normal is for typical 1024x768 screen (i.e. 15" monitors). ... Photos look incredible on it. ... Large . ... Normal . ... Thumbnails . ... Contents with thumbnails: Large | ... Nara, one of the historical cities of Japan . ... August 17, Sunday. ... Nara. ... return to photo album contents | ...

Еще в разделе: (Показать все результаты (>8712) - crydee.sai.msu.ru/ )

• Interplanet Janet
• Photo album: Crimea, June 1998

Off-centering of impurities is an interesting phenomenon that was discovered in 1965 in KCl crystals doped with Li. ... Investigation of narrow-gap IV-VI semiconductors (mainly lead telluride PbTe and lead selenide PbSe) doped with off-center impurities (like germanium or sulfur) attracts much attention due to impurity-induced phase transitions in these incipient ferroelectrics. ... A.I. Lebedev and I.A. Sluchinskaya. ... A.I. Lebedev, I.A. Sluchinskaya, V.N. Demin and I.H. Munro. ... Russian Acad. ...

Еще в разделе: (Показать все результаты (>80) - scon155.phys.msu.su/ )

• Off-centering of Pb and Sn impurities in GeTe induced by strong local stress

... Moscow, Russia . ... March-October 2000 . ... Gusev A.S. Multicolor CCD Photometry of Six Lenticular and Spiral Galaxies. ... Gusev A.S., Park M.-G. Structure and stellar population of ringed barred galaxy NGC 2336 // Astronomy and Astrophysics, 2003, V.410, P.117-129. ... Gusev A.S. Photometric Properties of Bars in Galaxies // Astronomy Reports, 2000, V.44, N9, P.579-591. ... Gusev A.S. BVRI CCD Photometry of Pecular Galaxies NGC 5605 and NGC 5665 // Astronomy Reports, 2000, V.44, N9, P.569-578. ...

Еще в разделе: (Показать все результаты (>351) - lnfm1.sai.msu.ru/ )

• Yuri Nicolaevich Efremov - My Home Page
• List of publications
• Maidanak Lab page

The main purpose of the new MCQDPT2 code is to speed up calculations in the cases of medium to large basis sets and medium to large active spaces using resolvent fitting (aka table-driven) approach. ... In the latter cases it is recommended to use the default PC GAMESS/Firefly' MCQDPT2 code. ... P2P Parallel Mode Communication Interface, Dynamic Load Balancing, and large-scale MP2 Energy code . New MP2 gradient code documentation . PC GAMESS/Firefly' NBO code . ...

Еще в разделе: (Показать все результаты (>90) - classic.chem.msu.su/ )

• Firefly/PC GAMESS DOCUMENTATION - LARGE SCALE CI, MCSCF, and QDPT2
• Large files support in the PC GAMESS/Firefly

. Update is coming soon.

Еще в разделе: (Показать все результаты (>130) - comet.sai.msu.ru/ )

• The IMG (Image) Element
• Dm. Bizyaev's Publications

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>2486) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/deltaaligned.fasta

International Laser Center of MSU . Home . ... Education . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... March 21, 2014 . 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Science and education Papers . ... 2009 ILC MSU Made in: Sebekon IT Solutions . ...

Еще в разделе: (Показать все результаты (>701) - ilc.phys.msu.ru/ )

Chair of General Physics and Wave Processes, Physics Faculty of MSU . Main . ... Science and education . ... Scientific Laboratories . ... Science . ... Education . 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . ... Main Science and education Papers . ... Laboratories: Laboratory of adaptive optics . ... 2009 ILC MSU Made in: Sebekon IT Solutions . 2009 Chair of GP and WP, physical department Made in: Sebekon IT Solutions . ...

Еще в разделе: (Показать все результаты (>698) - ofvp.phys.msu.ru/ )

... The First (Experimental) International Astronomy Olympiad . The following olympic problems were proposed for the participants on the theoretical part: Grades 8-10 . ... Why is it sometimes better to use a small telescope in orbit around the Earth than it is to use a large telescope on a mountain top? ... What will an observer looking to the Moon through the telescope see? ... Paper with a drown circle and table of maximal elongations of Mercury and Venus had been done for participants. ...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• The International Olympiad of Euro-Asian Astronomical Society

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Large-lexicon attribute-consistent text recognition in natural images . ... Conference Paper . ... Conference Name . ... Project: Text detection and recognition in natural images . ...

Еще в разделе: (Показать все результаты (>863) - graphics.cs.msu.ru/ )

• A system for large-scale automatic traffic sign recognition and mapping |

... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>61) - old.philol.msu.ru/ )

• Dmitry V. Khmelev: List of Publications

Axial Anomaly and Strange Strange Quarks FOURTEENTH LOMONOSOV CONFERENCE ON ELEMENTARY PARTICLE PHYSICS Moscow, MSU, August 21 2009 Oleg Teryaev JINR, Dubna Outline Axial anomaly for massless and massive fermions: decoupling Axial anomaly and Heavy quarks polarization in nucleon When strange quarks can be heavy: multiscale hadrons Support: small higher twist with IR QCD coupling Charm/strange universality? ...

Еще в разделе: (Показать все результаты (>200) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/250809/Vysotsky.pdf
• http://nuclphys.sinp.msu.ru/conf/epp10/Kupsc.pdf

... Д. л. кДлнйкЙмЦЗ еУТНУ,ТНЛИ ,,УТЫ ТЪ,ВММњИ ЫМЛ,В ТЛЪВЪ ЛП. е.З. гУПУМУТУ, унй нДдйЦ "тдДгД кДллнйьзав" ї кТЪУ ,,ЫВ, Д.л., 1999 , , - , . ... XX , кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 91 , , , . ... 1 -0,4 3 0 0,4 (B-V)0 0,8 1,2 1,6 -2 5 0 7 V 9 2 Mv 4 11 6 M45 13 8 0 0,4 0,8 B-V 1,2 1,6 . ... кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 93 1950 +24њ +22њ +20њ +18њ +16њ +14њ +12њ Ori Ori Ori +6њ 50 40 30 20 10 0 1950 Tau +10њ +8њ 20 10 0 6 h 5h 50 40 30 20 10 0 4h 50 40 +4њ 3h . ...

Еще в разделе: (Показать все результаты (>162) - www.pereplet.ru/ )