Comparative mineralogy of carbonatite complexes belonging to different formations . ... I. Within well known formation of ultrabasic -alkaline rocks within carbonatites (UAC), the main rare metal ore components are Nb, Zr, REE Ce , rarely Sr, Ba, U, Ta, Th, as well as phosphorus in apatite, in zones of hypergenesis ? minerals of crandallite group and others; fluorite, Fe in magnetite, rarely hematite and its hydroxides, sulfides of non-ferrous metals ? Cu, Zn and others. ...

Еще в разделе: (Показать все результаты (>965) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/ZaitsevV2.htm
• http://geo.web.ru/conf/alkaline/2009/aoifebrady.htm
• http://geo.web.ru/conf/khitariada/1-2003/informbul-1_2003/magm-11e.pdf

... Humanitarian Component As A Part Of International Business Curriculum . ... This article will address the issues and challenges involved in the teaching of history to Russian students who do not specialize in the social sciences. ... My courses in the International Business Faculty of Omsk State University are listed and classified as "Special Courses in English." ... First, they see our courses as English courses, and not history courses. ...

Еще в разделе: (Показать все результаты (>123) - www.prof.msu.ru/ )

... In this first example, we allow an object to fall onto a small radar unit . The resulting Time-Frequency distribution is shown as a contour plot in Fig. 8 (a). Figure: FIGURE GOES SOMEWHERE IN THIS GENERAL VICINITY . ... Its density plot appears as an image in Fig. ... The response has a very high peak, as evidenced from Fig. ...

Еще в разделе: (Показать все результаты (>1824) - crydee.sai.msu.ru/ )

• SunSoft
• Dynamic HTML in Communicator

... Главная Cотрудничество ILC of Bratislava ILCB laboratories Laboratory of Optical Diagnostics and Visualization Multipurpose all-solid femtosecond laser complex . Generation and application of the ultrashort laser pulses is one of the modern trends in photonics. ... In addition, the high-power femtosecond laser pulses can help in precise microprocessing of the materials. ... Solar LF2210 pulsed Nd:YAG laser (Solar TII, Belarus) . ... ILC and ILCB Cooperation ][ ILC MSU Main Page ] . ...

Еще в разделе: (Показать все результаты (>89) - ilc.phys.msu.ru/ )

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15210) - lib.mexmat.ru/ )

• Lowy J. - Programming .NET Components :: Электронная библиотека попечительского
• Carleson L., Gamelin T.W. - Complex dynamics :: Электронная библиотека
• Zhao S., Zhang R. - 2^m*4^n designs with resolution III or IV containing clear

Astronomy Picture of the Day . ... Some of the stars that form the constellation of Orion are part of a giant gas cloud complex that stretches over 100 light years and appears more than 50 times the diameter of the Moon. Components of this cloud include the Horsehead Nebula , the Orion Nebula , the Trapezium open cluster , and small disks containing stellar systems which are just forming. ... 1997 1998 . ... Publications with keywords: nebula - Orion . Publications with words: nebula - Orion . ...

Еще в разделе: (Показать все результаты (>9870) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Orion: The Big Picture
• Spacecraft Rosetta Shows Comet has Two Components

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>266) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/48.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/37.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/19.pdf

sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase ; MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAI AAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ ... EMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAP GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL QIRIMNDENFQHGGTNIHYLEKKLGLQEK sp|P24182|ACCC_ECOLI Biotin ...

Еще в разделе: (Показать все результаты (>1434) - kodomo.cmm.msu.ru/ )

• DNA-protein complex
• gene functions, GO

... Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by molecular mechanics using a force field based on the Gillespie-Kepert model . ... Abstract - A new approach combining the molecular mechanics (MM) method and the Gillespie- Kepert model was applied to calculate the geometry and strain energy of zinc(II) and cadmium(II) complexes with amino- and pyridyl-containing ligands. ...

Еще в разделе: (Показать все результаты (>73) - analyt.chem.msu.ru/ )

• Molecular mechanics study of the mixed-ligand lanthanide complexes using
• analyt

KLogic . KLogic is an application for easy building and simulating digital circuits. It provides an easy way for building circuits containing standard components like AND, OR, XOR and flipflops like RS and JK. To build more complex and reuseable circuits, you can create sub circuits. ... http://www.a-rostin.de/klogic/ . ... Software/Hardware Requirements: . ... None . ... SAL Home | Other Scientific Fields | Electrical Related Software . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>3459) - www.sai.msu.su/ )

• SAL- Programming - Tools & Utilities - STL
• APOD: December 1, 1997 - Orion: The Big Picture
• SAL- Mathematics - Misc - Java Microscope

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Research Centers . ... Search Faculties Staff . Education . ... Research . ... Education research . ... 7 495 939-16-82, . ... Faculty of Physics, 2016 . ... official site . the Ministry of Education and Science . ... official site <div><img src="https://mc.yandex.ru/watch/35023620" style="position:absolute; left:-9999px;" alt="" /></div> ...

Еще в разделе: (Показать все результаты (>221) - phys.msu.ru/ )

• Физический факультет МГУ им. М. В. Ломоносова

Network Working Group S. Legg Request for Comments: 3727 Adacel Technologies Category: Standards Track February 2004 ASN.1 Module Definition for the LDAP and X.500 Component Matching Rules Status of this Memo This document specifies an Internet standards track protocol for the Internet community, and requests discussion and suggestions for improvements. ... All Rights Reserved. ... Legg Standards Track [Page 1] RFC 3727 Module for Component Matching February 2004 2. ...

Еще в разделе: (Показать все результаты (>19266) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc3727.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc4421.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc4421.txt

Geology at Moscow State University . ... Geology and geochemistry of ore deposits . ... The Chair provides all students studying at the Faculty of Geology with the core lecture-based course in petrology. ... Students specializing in the field of petrology are offered courses "Rock-forming Minerals", "Thermodynamics of Minerals", "Formations of Igneous Rocks", "Petrochemistry", "Petrology of Meteorites and Impactites", "Formations of Metamorphic Rocks", "Experimental and Technical Petrography". ...

Еще в разделе: (Показать все результаты (>131) - www.geol.msu.ru/ )

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... Every package built for RPM has to have a specific set of information that uniquely identifies it. We call this information a package label. ... Every package label begins with the name of the software. ... Next in the package label is an identifier that describes the version of the software being packaged. ... When a package file is created, part of the filename consists of the package label. ... The information includes: . ...

Еще в разделе: (Показать все результаты (>348) - uneex.lorien.cs.msu.su/ )

• mod_dav - Apache HTTP Server

... It contains INCLUDE sections to build a "create new topic" form. ... Create a form with an empty name field: %INCLUDE{ "%SYSTEMWEB%.WebCreateNewTopicComponents" section="newtopic" newtopic="" }% . ... STARTSECTION { newtopic }%% INCLUDE { % TOPIC % section = js }%% INCLUDE { % TOPIC % section = formstart }%% INCLUDE { % TOPIC % section = topicname }%% INCLUDE { % TOPIC % section = submit }% % INCLUDE { % TOPIC % section = topicnamefeedback }%% INCLUDE { % TOPIC % ...

Еще в разделе: (Показать все результаты (>5164) - wiki.cmc.msu.ru/ )