Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Издательство: Georg Thieme Verlag . ... Makukhin N.N. , Goulioukina N.S. , Bessmertnykh-Lemeune A.G. , Brand?s S. , Guilard R.r. , Beletskaya I.P. в журнале Synthesis , издательство Georg Thieme Verlag (Germany) , том 47, ? ... в журнале Synthesis , издательство Georg Thieme Verlag (Germany) , том 44, ? ...

Еще в разделе: (Показать все результаты (>2007) - istina.msu.ru/ )

• Advanced Synthesis and Catalysis - журнал | ИСТИНА - Интеллектуальная Система
• SYNTHESIS-STUTTGART - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Current Organic Synthesis - журнал | ИСТИНА - Интеллектуальная Система

... About lab . ... Selected publications . Publications . ... Courses . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . Educational courses (in russian) . ... An Approach to Cloth Synthesis and Visualization. Publication Type . Conference Paper . Year of Publication . ... Conference Name . ... Publication Language . ...

Еще в разделе: (Показать все результаты (>14) - graphics.cs.msu.ru/ )

• Image Registration: Color Image Synthesis from Data Obtained from Satellites
• An Approach to Cloth Synthesis and Visualization. | Лаборатория компьютерной

of the division of INORGANIC CHEMISTRY . Boris A. Popovkin , Professor, Dr.Sci. - head of the laboratory since 1987 . The Laboratory was founded in 1953 by Academician A.V. Novoselova. ... Vladimir A. Alyoshin, Ph.D., Associate Professor . Elena I. Ardashnikova, Ph.D., Associate Professor . ... Professor . ... The principles of inorganic synthesis (Prof. B.A. Popovkin). Soft and selective synthesis of some inorganic substances (Prof. B.A. Popovkin, Leading Scientist V.A. Dolgikh). ...

Еще в разделе: (Показать все результаты (>727) - chem.msu.ru/ )

• Laboratory of organic synthesis
• Synthesis and Characterisation of 1-[9-(H, Me3Si, Me3Ge, Me3Sn)-9-Fluorenyl]-
• Synthesis of highly crowed cyclopentadienes via reactions of Cp2Ni and

Электронная библиотека Попечительского совета . ... Vardanyan R.S., Hruby V.J. - Synthesis of Essential Drugs . ... Название: Synthesis of Essential Drugs . Авторы: Vardanyan R.S., Hruby V.J. Аннотация: . ... Of the thousands of drugs existing on the pharmaceutical market, we mainly discuss generic drugs that are included in the WHO's "Essential List of Drugs." ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1701) - lib.mexmat.ru/ )

• Поиск книг, содержащих chemical synthesis, of $C^{60}$ :: Электронная
• Ono N. - The nitro group in organic synthesis :: Электронная библиотека
• Boldi A.M. - Combinatorial Synthesis of Natural Product-Based Libraries ::

... A problem of synthesis of nano-optical elements for the formation of dynamic images" . Goncharsky A.A., Durlevich S.R. The inverse problems of synthesis of nano-optical elements for the formation of dynamic images that change their position as the flat optical element is tilted are considered. The inverse problem of computing the microrelief of nano-optical elements is solved in the framework of the Fresnel scalar wave model. ...

Еще в разделе: (Показать все результаты (>22) - num-meth.srcc.msu.ru/ )

• On a problem of the synthesis of nano-optical protection elements
• "On the problem of synthesis of nano-optical elements"
• "A synthesis of simplex and linear correction methods for linear optimization

P. Frick, D.Sokoloff, R. Stepanov, R. Beck)Faraday rotation measure synthesis for magnetic fields of galaxies, MNRAS, {\bf 414}, N3, 2540 - 2549, 2011 . ... Here we consider how to apply RM synthesis to reconstruct the Faraday dispersion function, aiming at the further extraction of information concerning the magnetic fields of extended sources, for example galaxies. ... We describe the contribution of small-scale fields in terms of Faraday dispersion and beam depolarization. ...

Еще в разделе: (Показать все результаты (>23) - srcc.msu.ru/ )

• V. Pervak, M.K. Trubetskov, A.V. Tikhonravov, Robust synthesis of dispersive
• Michael K. Trubetskov and Alexander V. Tikhonravov. Robust synthesis of
• Beck R., Frick P., Stepanov, R., Sokoloff D. Recognizing magnetic structures by

... SYNTHESIS OF ZIEGLER-NATTA CATALYSTS SUPPORTED ON SOL-GEL MATERIAL AND ITS APPLICATION IN GAS-PHASE AND SLURRY POLYMERIZATION OF ETHYLENE . ... Heterogenization allows regulating polymer morphology as well. ... Our earlier results showed that new silica-type material obtained in sol-gel process may be successfully used as a support of organometallic catalysts for ethylene polymerization [1-4]. ... activity of supported Ziegler-Natta catalysts in gas-phase and slurry polymerization. ...

Еще в разделе: (Показать все результаты (>163) - www.chem.msu.ru/ )

• Лаборатория химии поверхности - ПУБЛИКАЦИИ ПОСЛЕДНИХ ЛЕТ

.

Еще в разделе: (Показать все результаты (>663) - www.chemport.ru/ )

• Бор треххлористый, for synthesis, (мелкая уп.) - компании-поставщики этого
• Титан треххлористый, 15%-ный р-р, for synthesis, (мелкая уп.) -
• Алюминий гранулированный, for synthesis, (мелкая уп.) - компании-поставщики

Back to homepage >> . Trusov S.V., Pletchov P.Yu. and Kotelnikov A.R. The aim of this work was a melt inclusion synthesis during the process of new phase growth on natural crystals of similar composition. ... Such effect is observed at feldspar crystallization on the inclusion walls. ... It allows one to observe the evolution of melt composition by the study of melt inclusion compositions in the different newly- formed zones. ...

Еще в разделе: (Показать все результаты (>82) - geo.web.ru/ )

BIOH _CITK8 A8AQW5 RecName : Full = Carboxylesterase bioH ; EC= 3.1.1.1 ; AltName : Full = Biotin synthesis protein bioH ; M-NDIWWQTEGQGNCHLVLLHGWGLNAEVWNCIRE-ELSAHFTLHLVDLPGFGRS-- QGF GAMSLEQMAKHVLKQAPDKAVWLGWSLGGLVASQVALTHPERVQALVTVASSPCFSAREA WP-GIKPDILAGFQQQLSEDFQRTVERFLALQTLGTETARQDARTLKSAVLALPMPEVAV LNGGLEILKTADLREPLKSLTMPFLRLYGYLDGLVPRKVVPMLDAA ...

Еще в разделе: (Показать все результаты (>128) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~lu.andreeva/my_aligned.fasta
• http://kodomo.cmm.msu.ru/~lu.andreeva/myproteins_aligned.fasta
• PubMed

Davydova, N.K. Synthesis and reactions of 3-nitro-4-oxo-1,4-dihydroquinolines.- ... L'vov, A.I., Sizova, O.S., Davydova, N.K., Glushkov, R.G. New process for the synthesis of antiatherosclerotic drug gemfibrozil.- ... Glushkov, R.G., L'vov, A.I., Sizova, O.S., Davydova, N.K., Sanzharova, G.M., Polyakova, M.Ya., ... Glushkov, R.G., L'vov, A.I., Sizova, O.S., Davydova, N.K., Balashova, I.A., Solov'eva, N.P., Anisimova, O.S. Use of the Koch-Haaf's Reaction in the new synthesis of gemfibrozil. ...

Еще в разделе: (Показать все результаты (>131) - polly.phys.msu.ru/ )

• Selected publications of Blagodatskikh, Inesa Vasilievna
• New Methods of Organosilicon Chemistry - Chair of Polymer and Crystal Physics
• Selected publications of Keshtov, Mukhamed Lostanbievich

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>31) - sn.sai.msu.ru/ )

... Composing of New Materials Using the Method of Self-Propagating High-Temperature Synthesis in Presence of Ultrasonic Vibrations . ... One of the promising techniques of the manufacture of new materials with a wide complex of various properties is the method of self-propagating high-temperature synthesis (SHS). The essence of the SHS method lies in conducting the process in the regime of combustion due to exothermal reaction of components without the use of considerable external heating. ...

Еще в разделе: (Показать все результаты (>6) - acs366.phys.msu.su/ )

• AUTHOR : Klubovich V
• AUTHOR : Kulak M

Synthesis of bioavailable zinc-humic compounds Evgeny M. Garanin1, Vladimir M. Zelikman1, Olga I. Philippova2, Natalia A. Kulikova2, Tatiana A. Sorkina1, Irina V. Perminova1 Department of Chemistry, Lomonosov Moscow State University, Moscow, Russia, jgaranin@yahoo.com 2 Department of Soil Science, Lomonosov Moscow State University, Moscow, Russia 1 Goal of this research was synthesis of humic-based compounds of zinc and to evaluate zinc bioavailability for plants. ...

Еще в разделе: (Показать все результаты (>58) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2010/2010-polyakov-synthesis.pdf
• http://www.mgumus.chem.msu.ru/publication/2006/2006-perminova-synthesis.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-sorkina-synthesis.pdf

... ATPase/synthase activity of Paracoccus denitrificans Fo.F1 as related to the respiratory control phenomenon. ... The time course of ATP synthesis, oxygen consumption, and change in the membrane potential in Paracoccus denitrificans inside-out plasma membrane vesicles was traced. ... At pH7.0, no reversal of the ATP synthase reaction by the uncoupler was seen. ... Possible mechanisms of kinetic control and unidirectional operation of the Fo.F1-ATP synthase are discussed. ...

Еще в разделе: (Показать все результаты (>13) - biochem.bio.msu.ru/ )

• Paracoccus denitrificans proton-translocating ATPase: kinetics of oxidative
• Oxidative phosphorylation and respiratory control phenomenon in Paracoccus

... 5 8: 5 5 8 , 2He, 3Li 4Be . ... 2000 .. ... 10 10 10 10 10 8 6 4 102 1 10 -2 0 20 40 60 80 100 120 140 160 180 200 220 . ... 1,5 108 , 5 104 /3, 12 C. 34He 12C . 8Be 4He. ... 12C + 4He 12 16 C O 34He 12 C(, )16O. , . ... 20Ne , 16O + 4He, . ... 238U. , 255 U 17 238U + 17n -- .. ... C, N, O C 120 110 100 90 80 70 60 50 N = 50 - N = 126 Z = 114 - - A = 208 A = 195 Z = 82 N = 82 s- (n, f) A = 138 A = 130 Z = 50 r- 40 30 20 40 Z = 28 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 N " " . ...

Еще в разделе: (Показать все результаты (>11) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/1968_6b.pdf
• http://nuclphys.sinp.msu.ru/mirrors/1996_02d.pdf
• http://nuclphys.sinp.msu.ru/mirrors/1998_6c.pdf

... Laboratory of Medicinal Chemistry was established at the Department of Chemistry, Lomonosov Moscow State University in October 2013. ... We apply modern molecular modeling and chemoinformatics methods as well as develop new approaches. ... We have developed efficient methods for the analysis of quantitative structure-activity relationships and design of novel promising structures based on diverse theoretical approaches. ... Home . ... Research . ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>9) - qsar.chem.msu.ru/ )

по текстам по ключевым словам в глоссарии по сайтам перевод . ... Воднев В. Г., Наумович А. Ф., Наумович Н. Ф. Математический словарь высшей школы. ... Synthesis Imaging in Radio Astronomy II // ASP Conf. ... Interferometry and Synthesis in Radio Astronomy. ... Публикации с ключевыми словами: Радиоинтерферометр . Публикации со словами: Радиоинтерферометр . ... Все публикации на ту же тему >> . Обсудить эту публикацию . ...

Еще в разделе: (Показать все результаты (>1556) - www.astronet.ru/ )

• Астронет > Семинар лаборатории ядерных реакций ОИЯИ
• Астронет > Англо-Русский Словарь
• Астронет > Семинары на 03 июня 2002

International Laser Center of MSU . Home . ... Education . ... Grants . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... March 21, 2014 . 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Research Grants . ... 2009 ILC MSU Made in: Sebekon IT Solutions . ...

Еще в разделе: (Показать все результаты (>9) - ilc.phys.msu.ru/ )

Moscow State University Belozersky Institute of Physico-Chemical Biology . Department of Electron Microscopy is a sub-division of A.N. Belozersky Institute of Physico-Chemical Biology . ... We are interested of how eukaryotic cell is organized, formed and functioned. Since A.N. Belozersky Institute of Physico-Chemical Biology is one of the scientific departments of Moscow State University ? ... Understanding the metaphase chromosome architecture remains a basic challenge in cell biology. ...

Еще в разделе: (Показать все результаты (>2) - cellbiol.genebee.msu.ru/ )