1. "Delta Orbital"
.
[
]
http://www.chemport.ru/tradecenter.php?q=Delta0976Orbital -- 17.8 -- 12.04.2016
:
(
(>10) - www.chemport.ru/ )
2. DELTA
Gnumeric . Prev . Next . ... , #VALUE!. Excel. ... EXACT , GESTEP . ... DEGREES . ... DEVSQ ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
:
(
(>10) - uneex.lorien.cs.msu.su/ )
4. : Delta - Public forum of MSU united student networks
... -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . : Delta . ... Common . ... msu_td . ... Delta . ...
[
]
http://www.snto-msu.net/ratingdetails.php?username=Delta&showlite= -- 21.8 -- 10.04.2016
:
(
(>310) - www.snto-msu.net/ )
5. First Launch of the Delta IV Heavy
... First Launch of the Delta IV Heavy . ... 26.01.2005 . ... Credit: Ecliptic Enterprises Corporation , Boeing , USAF Explanation: The new Delta IV Heavy Launch Vehicle is the largest rocket ever to be launched by the US Air Force . ... The first launch of the Delta IV Heavy occurred last month and was largely successful with the exception that the boosters shut off several seconds prematurely. ... Pictured above , the Delta IV Heavy is seen lifting off by a RocketCam perched on its side. ... 2005 2006...
[
]
http://www.astronet.ru/db/xware/msg/apod/2005-01-26 -- 14.6 -- 26.01.2005
:
(
(>4088) - www.astronet.ru/ )
6. APOD: 2005 January 26 - First Launch of the Delta IV Heavy
... 2005 January 26 . First Launch of the Delta IV Heavy . ... Explanation: The new Delta IV Heavy Launch Vehicle is the largest rocket ever to be launched by the US Air Force . ... The first launch of the Delta IV Heavy occurred last month and was largely successful with the exception that the boosters shut off several seconds prematurely. ... Pictured above , the Delta IV Heavy is seen lifting off by a RocketCam perched on its side. ... About APOD | ...
[
]
http://www.sai.msu.su/apod/ap050126.html -- 5.2 -- 02.10.2012
:
(
(>233) - www.sai.msu.su/ )
7. W Delta Z - - Kinfo.ru
... -> -> W Delta Z . ... . ... W Delta Z . ... 2007 . ... Tom Shankland . ... Tom Hardy . ... Peter Ballance . ... Alibe Parsons . ... Barbara Adair . ... Selma Blair . ...
[
]
http://kinfo.ru/Movie/02562774-9c3f-4a07-abc7-00a26b966329 -- 8.6 -- 11.04.2016
8. Index of /pub/gentoo-portage/app-text/delta/
. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:20:02 . 2.3K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 1.9K . application/octet-stream . Manifest . 2016-Jan-25 18:20:02 . 1.8K . application/octet-stream . delta-20060803.ebuild . 2015-Aug-09 03:38:18 . 0.7K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.5K . text/xml . lighttpd/1.4.35
[
]
http://mirror.msu.net/pub/gentoo-portage/app-text/delta/ -- 3.2 -- 10.04.2016
:
(
(>773) - mirror.msu.net/ )
9. Brown M.C. - Microsoft IIS 6 Delta Guide ::
. ... Brown M.C. - Microsoft IIS 6 Delta Guide . ... : Microsoft IIS 6 Delta Guide . : Brown M.C. : . Microsoft's Internet Information Server 6 is an Internet server program that works with the Windows Server 2003 operating system. IIS is Microsoft's answer in the Internet server market to Apache, the open source and #1 Internet server in use. ... , 2004-2016 . ...
[
]
http://lib.mexmat.ru/books/19540 -- 15.2 -- 10.04.2016
:
(
(>1020) - lib.mexmat.ru/ )
10. http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
sp|P0C6M3|LHDAG_HDVP1 Large delta antigen ; MSQTVARLT-SKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLL- RRKKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGG KHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPF SRTGEGIDIRGTQQFPWYGFTPPPPGYYWVPGCTQQ sp|Q81842|SHDAG_HDVP1 Small delta ...
[
]
http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta -- 9.8 -- 20.04.2009
[
]
http://kodomo.cmm.msu.ru/~lesya/images/delta_muscle.fasta -- 9.8 -- 24.05.2009
:
(
(>981) - kodomo.cmm.msu.ru/ )
12. Index of manual pages: S
... Manual pages are often copyrighted material. ... If these links return an error message, view the page locally instead. sccs - front end for the Source Code Control System (SCCS) . sccs-admin , admin - create and administer SCCS history files . sccs-cdc , cdc - change the delta commentary of an SCCS delta . ... sccs-prs , prs - display selected portions of an SCCS history . sccs-prt , prt - display delta table information from an SCCS file . ... size - display the size of an object file . ...
[
]
http://comet.sai.msu.ru/UNIXhelp/alphabetical/ms.html -- 6.7 -- 17.01.1997
:
(
(>147) - comet.sai.msu.ru/ )
13. http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps
Lambda ########### f : X \Theta X ! ... f \Gamma1 = ffi f ffi , ### (a; b; c; d) = (\Gammaa; b; \Gammac; d). ##############. ##### ############ ##### #########, ### ########### f r (a; b; c; d) = i a + ab + bc; bcd bc + a(1 + b)(1 + d) ; acd a + c + ad ; bc + a(1 + b)(1 + d) c j ; (3) ########## ## f ####### ######## +; \Gamma; max ## \Delta; =; + ##############, ######## ############ ####-- ######## ## R 2 + . ... Quantum groups (Leningrad, 1990), 1--8, Lecture Notes in Math., ... Math. ...
[
]
http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps -- 138.0 -- 22.02.2005
:
(
(>20) - higeom.math.msu.su/ )
14. epsf.sty
, PostScript . \documentstyle[ epsf ]{article} \twocolumn \begin{document} Her X-1 is one the first X-ray binary pulsar discovered by the eminent UHURU satellite in 1972 (Tananbaum et al. 1972, Giacconi et al. 1973) and since then remains one of the most studied accretion-driven X-ray stellar binaries. ... 1972). ...
[
]
http://xray.sai.msu.ru/~mystery/html/latex/epsf.html -- 3.7 -- 16.09.1998
:
(
(>155) - xray.sai.msu.ru/ )
15. MAREZIO M. - | -
: \ . ... . ... Capponi J.J. , Kopnin E.M. , Loureiro S.M. , Antipov E.V. , Gautier E. , Chaillout C. , Souletie B. , Brunner M. , Tholence J.L. , Marezio M. Physica C , 256, ? 1-2, . 1-7 DOI . ... 3-4, . 401-406 DOI . ... 2, . 406-409 DOI . ... 3-4, . 265-272 DOI . ... 5130, . 97-99 DOI . ...
[
]
http://istina.msu.ru/workers/455271/ -- 44.4 -- 10.04.2016
:
(
(>452) - istina.msu.ru/ )
16. > !
... : ! > > . Delta . ... 10- 11- . ... , ? . ... , ? ... , , "" . ...
[
]
http://wasp.phys.msu.ru/forum/lofiversion/index.php?t2718.html -- 9.3 -- 11.04.2016
:
(
(>135) - wasp.phys.msu.ru/ )
17. allpy: 0c3c1856113a
... allpy/base.py allpy/pdb.py . ... allpy/base.py . ... allpy/pdb.py . ... 1.1 --- a/ allpy /base.py Thu Dec 16 20:45:57 2010 +0300 1.2 +++ b/ allpy /base.py Thu Dec 16 20:47:09 2010 +0300 1.3 @@ -380,61 +380,6 @@ 1.4 string = ''.join([m.type.code1 if m else '-' for m in block_monomers]) 1.5 save_fasta(out_file, string, sequence .name, sequence .description, long_line) 1.6 1.7 - def geometrical_cores(self, max_ delta =config. delta , 1.8 - timeout =config. timeout , minsize=config.minsize, 1.9 - ...
[
]
http://kodomo.fbb.msu.ru/hg/allpy/rev/0c3c1856113a -- 18.6 -- 01.10.2012
:
(
(>2511) - kodomo.fbb.msu.ru/ )
18. jo0017
... Hour of right ascension (alpha, h), B1950.0 6. ... Degree of declination (delta, deg), B1950.0 9. ... Unsertainty in Delta(delta), arcsec --------------------------------------------------------------------------------------------- Year alpha delta alpha delta Unsertainties N month B1950.0 B1950.0 J2000.0 J2000.0 D(alpha) D(delta) sat day h m s deg ' '' h m s deg ' '' cos(delta) with decimals arcsec arcsec --------------------------------------------------------------------------------------------- ...
[
]
http://www.sai.msu.ru/neb/nss/OBS_COLL/J/jo0017.html -- 4.5 -- 22.06.2004
[
]
http://lnfm1.sai.msu.ru/neb/nss/OBS_COLL/J/jo0017.html -- 4.5 -- 22.06.2004
:
(
(>241) - lnfm1.sai.msu.ru/ )
19. p32.mpc | PARALLEL.RU - -
... p32.mpc . include stdio.h # include stdlib.h # include math.h # include mpc.h # define DELTA (0.5) typedef struct { double len ; double wid ; double hei ; double mass ; } rail ; nettype HeteroNet ( int n , double v [ n ]) { coord I = n ; node { I =0: v [ I ];}; parent [0]; }; double Density ( double x , double y , double z ) { return 6.0* sqrt ( exp ( sin ( sqrt ( x * y * z ) ) ) ); } double RailMass ( ... . ...
[
]
http://www.parallel.ru/tech/mpc/p32.html -- 18.0 -- 09.04.2016
:
(
(>21) - www.parallel.ru/ )
20. SCOP classification
... Resolvase-like . ... gamma,delta resolvase, catalytic domain . protein domain . ... Escherichia coli [TaxId: 562] . ...
[
]
http://monkey.belozersky.msu.su/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 04.02.2013
[
]
http://mouse.belozersky.msu.ru/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 05.02.2013
[
]
http://monkey.belozersky.msu.ru/npidb/cgi-bin/scop.pl?cl=51349&cf=53040&sf=53041&fa=53042 -- 6.0 -- 04.02.2013
:
(
(>60) - monkey.belozersky.msu.ru/ )