PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>500) - oit.cmc.msu.ru/ )

ПЕРВЫЕ РАЗВЕДЧИКИ ЛУНЫ . ... Интересно, что полет станции можно было наблюдать и визуально - специальное устройство, установленное на последней ступени ракеты-носителя (а она мчалась почти по той же траектории, что и отделившаяся от нее станция), выбросило на высоте около 100 тыс. км натриевое облако. Эту искусственную комету видели люди во многих странах. 12 сентября 1959 года к спутнику нашей планеты стартовала автоматическая станция "Луна-2". ... Автоматическая межпланетная станция "Луна-3" . ...

Еще в разделе: (Показать все результаты (>170) - selena.sai.msu.ru/ )

• Лекции
• Луноход
• Луна 9-10

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>42) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>18279) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>34763) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow  ( QWidget * parent=0, const char * name=0, WFlags f=0 )  . QWindow  ()  . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>705) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - biff/biff.cpp example file
• Qt Toolkit - qwindowdefs.h include file
• Qt Toolkit - dirview/dirview.cpp example file

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>6) - acs366.phys.msu.su/ )

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>600) - kodomo.cmm.msu.ru/ )

• Term4
• Pouliakhina's page
• Term1

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>1025) - phys.msu.ru/ )

... Главная -> Фильмы -> You Got Served . ... Фильмы . ... You Got Served . ... США 2004 . ... Chris Stokes . ... Lil' Fizz . ... Jerome Jones . ... Malcolm David Kelley . ... Christopher Jones . ... Irene Stokes . ... Kimberly 'Lil' Kim' Jones . ... David 'Elsewhere' Bernal . ... Aminah Abdul-Jillil . ...

Еще в разделе: (Показать все результаты (>471) - kinfo.ru/ )

• Time Served - Фильмы - Kinfo.ru
• Are You Being Served? - Фильмы - Kinfo.ru
• You Got Served, Take It to t.. - Фильмы - Kinfo.ru

. Адрес: 119992, ГСП-2, Москва, Ленинские горы, МГУ, Главное здание, А-1008 . тел.: (095) 939 37 67 факс: (095) 939 02 59 . Все права на материалы, опубликованные на сайте Управления, принадлежат МГУ им.М.В. Ломоносова. При использовании материалов сайта ссылка на наши выходные данные обязательна. Просим сообщать нам о замеченных неточностях и опечатках. Webmaster . 2002-2005 УОСиП МГУ All rights reserved .

Еще в разделе: (Показать все результаты (>23) - www.edst.msu.ru/ )

• Информация

Электронная библиотека Попечительского совета . ... Wit G.W. - Loss reserving methods . ... Название: Loss reserving methods . Автор: Wit G.W. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10281) - lib.mexmat.ru/ )

• Thurston C.M. - Language Is Served: Games, Writing Prompts, and Other Language
• Amin S., Das J., Goldshtein M. - Are You Being Served?: New Tools for Measuring
• Zuffoletto J. - BEA WebLogic Server Bible :: Электронная библиотека

... Post Office Box 786 . ... Post Office Box 197 . ... Post Office Box 161 . ... Originally published in Russian as Sistemologiya i yazikoviye aspekti kibernetiki . ... Melnikov. G. P. [Sistemologiya i yazikovye aspekty kibernetiki. ... Systemology and linguistic aspects of cybernetics/G. P. Melnikov: . ... Studies in cybernetics; v. 16) . Translation of: Sistemologiya i vazkovye aspektv kihernetiki. ... Cybernetics. ...

Еще в разделе: (Показать все результаты (>50) - old.philol.msu.ru/ )

• HumLang - Translation System

... Certificate of State Registration of Database № 2008620382 . ... Post adress: Moscow 119991, Leninskie Gory 1, MSU, Department of Physics, chair of Quantum Electronics . ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>43) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>55) - qilab.phys.msu.ru/ )

Astronomy Picture of the Day . ... 12.01.1998 . ... Officially designated NGC 3324, the Keyhole Nebula is a smaller region superposed on the larger Eta Carina Nebula . ... An emission nebula that contains much dust , the Keyhole Nebula is roughly 9,000 light years distant. ... 1997 1998 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: emission nebula - Keyhole Nebula - Eta Carinae . Publications with words: emission nebula - Keyhole Nebula - Eta Carinae . ...

Еще в разделе: (Показать все результаты (>14517) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Subrahmanyan Chandrasekhar 1910-1995
• Астронет > Subrahmanyan Chandrasekhar 1910-1995

. Сontacts . Home ? User account . Create new account . Log in . Request new password (active tab) . Username or e-mail address * . Selection committee . Site map . Site search . MSU website . Contacts . Contests . Application for participation . Facebook . vKontakte . Twitter . YouTube . This site (RSS) . E -mail: info@hsmi.msu.ru . Phone: +7 495 932-80-73 . Fax: +7 495 932-80-73 . 2006-2016 MSU Higher School of Management and Innovation. All rights reserved.

Еще в разделе: (Показать все результаты (>40) - hsmi.msu.ru/ )

. About the University . Application . FAQ . Electronic Resources . About the Faculty . Departments . Labs and Research Centres . Photo Archive . Please note that English & Russian versions of this site do not coinside . All rights reserved under Russian & International laws. Copyright © 1997-2011 Faculty of History, MSU. No part of this site may be reproduced electronically or otherwise without the prior written permission of the copyright owner.

Еще в разделе: (Показать все результаты (>38642) - hist.msu.ru/ )

const int nin_ is a number of incoming particles . const int nout_ is a number of outgoing particles . ... char processch[] contains the process name. It is needed to be only displayed on the screen during the n_comphep_c session. int pinf_(int nsub, int nprtcl, char *name, double * mass) returns the name and the mass of particle with the nprtcl ordering number for the subprocess nsub . First nin_ numbers are reserved for incoming particles, while next nout_ are assigned to outgoing ones. ...

Еще в разделе: (Показать все результаты (>14390) - theory.sinp.msu.ru/ )

• Independent parameters of the model
• [Ru-ngi] Fwd: [Noc-managers] Please add EGI voms servers for dteam to your site
• [RU-NGI] Fwd: [Noc-managers] Clarification for: Please add EGI voms servers for

... On the Institute . Status of the Institute . Institute Laboratory-Chairs . ... Library of Electronic Publications . ... Proceedings of the Institute . ... Collection of temporology screen savers . ... The Seminar program in the current semester . ... Abstracts of reports . Library of reports . Photogallery of the Seminar participants . ... 007 (495) 939-5560 . Russia, 119991, Moscow, Moscow State University, Faculty of Biology, Division of General Ecology. ...

Еще в разделе: (Показать все результаты (>1180) - chronos.msu.ru/ )

• Library of Electronic Publications