... BLAST (Basic Local Alignment Search Tool) is a set of similarity search programs designed to explore all of the available sequence databases regardless of whether the query is protein or DNA. ... The BLAST 2.0 search engine has been designed for optimal speed and sensitivity. ... Gapped BLAST and PSI-BLAST are useful search tools provided by the BLAST server (version 2.0) (Altschul et al., ... You can download blastcl3 form the anonymous FTP location ftp://ncbi.nlm.nih.gov/blast/network/netblast/ . ...

Еще в разделе: (Показать все результаты (>246) - www.genebee.msu.ru/ )

• Notes on searching by similarity
• Selected Scientific Journals - Search Engines
• GeneBee BLAST 2.2.8 Services Help

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>34) - mouse.genebee.msu.ru/ )

• Nhunt

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>28) - seac47-2.phys.msu.ru/ )

Blastall -------- Blastall may be used to perform all five flavors of blast comparison. ... A typical use of blastall would be to perform a blastn search (nucl. vs. nucl.) of a file called QUERY would be: blastall -p blastn -d nr -i QUERY -o out.QUERY The output is placed into the output file out.QUERY and the search is performed against the 'nr' database. ... The statistics are based on the 'virtual' database of nr and est. -i Query File [File In] default = stdin The query should be in FASTA format. ...

Еще в разделе: (Показать все результаты (>8862) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/cds_result.txt
• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/pyr_D.txt
• http://kodomo.cmm.msu.ru/~yaros/term3/BlockI/uchcodbel.txt

Full-Text Search in PostgreSQL: A Gentle Introduction . ... Full-Text Search ( FTS ) is a search for the documents, which satisfy query and, optionally, return them in some order . ... Moreover, modern information systems are all database driven and there is a need in IR (Information Retrieval) style full text search inside database with full conformance to the database principles ( ACID ). ... Search machines parse text files and store associations of lexemes (words) with their parent document. ...

Еще в разделе: (Показать все результаты (>9689) - www.sai.msu.su/ )

• Sternberg Astronomical Institute
• SAL- Other Scientific Fields - Chemistry, Biology Related - HMMER
• Net Search

The Chair of Mathematical Theory of Intelligent Systems and . Laboratory of Problems of Theoretical Cybernetics . ... MaTIS Chair . ... Research . ... Computer Solver . ... development of computer teaching systems . Information Monitoring . creating the systems of information monitoring . Search in Databases . systems of fast search in extensive databases . ... The Chair of Mathematical Theory of Intelligent Systems, Laboratory of Problems of Theoretical Cybernetics . ...

Еще в разделе: (Показать все результаты (>107) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Gasanov Elyar Eldarovich
• Intelligent Systems :: Research :: :: Research
• Intelligent Systems :: Research

What would you like to search for? ... Case sensitive Match whole word Recent publications first . ... What to do if you are looking for ... words iron and oxide in the same record: iron and oxide . both these words or chemical formulae: (iron and oxide) or Fe2O3 . ... That's why do not use Co instead of cobalt : you will find Co even in al co hol! ... The hidden part of the database allows you to use full names of chemical elements instead of the short ones (like nickel instead of Ni ). ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• Database: publications on x-ray absorption spectroscopy

... 32Bits Online: because there's more than one way to compute . New about new versions of computer related stuff . AAA Matilda Web Search . ... Search . ... The Music Database . ... Musicians looking for other musicians (Free Service) . ... The Mac Game Database uses PHP and MySQL . ... Bioinformatics databases at the Montreal Children's Hospital using MySQL . ... DSL providers search with reviews Made with MySQL and Modperl, all pages are generated dynamically out of the MySQL database . ...

Еще в разделе: (Показать все результаты (>366) - itpm.msu.su/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Chemists, Attention! Search on databases! ... Search on databases! [ re: olenka_chem ] . ... Search on databases! [ re: egoist ] . ... Из: IT UK CH . ...

Еще в разделе: (Показать все результаты (>14815) - www.fds-net.ru/ )

• Аналитик Executive Search - Public forum of MSU united student networks
• Fast SMB Search on SourceForge - Public forum of MSU united student networks

Электронная библиотека Попечительского совета . ... Korf I., Yandell M., Bedell J. - Blast (Basic Local Alignment Search Tool) . ... Название: Blast (Basic Local Alignment Search Tool) . Авторы: Korf I., Yandell M., Bedell J. Аннотация: . ... BLAST (Basic Local Alignment Search Tool), is a sophisticated software package for rapid searching of nucleotide and protein databases. ... BLAST is the only book completely devoted to this popular suite of tools. ... BLAST basics and the NCBI web interface . ...

Еще в разделе: (Показать все результаты (>12981) - lib.mexmat.ru/ )

• Papadopoulos A.N., Manolopoulos Y. - Nearest Neighbor Search: A Database
• Spink A., Jansen B.J. - Web Search: Public Searching on the Web :: Электронная
• Calishain T. - Web Search Garage :: Электронная библиотека попечительского

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>37242) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~smivic/Projects/Term_3/Downloads/gluq_pm.blast

. Please use the reference to MASTER DataBase as Lipunov et al., 2010, MASTER Robotic Net, Advances in Astronomy, vol. 2010, pp. 1-7 . - days . MASTER , 2002-2016

Еще в разделе: (Показать все результаты (>4) - apollo.sai.msu.ru/ )

• MASTER-II Kislovodsk

Database: . ... Affymetrix official site . ... Clone/Gene ID converter . ... Probe set search: . Affymetrix probe set identifier example: "200034_s_at" . ... Search . Text search: . Gene official symbol (*-wildcard) example: "c1orf*" . Word or phrase in gene official name example: "receptor" . ... Gene search: . ENSEMBL gene identifier example: "ENSG00000026508" . NCBI Entrez Gene identifier example: 7503 . ...

Еще в разделе: (Показать все результаты (>6991) - mouse.belozersky.msu.ru/ )

• MTPro

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>9) - npidb.belozersky.msu.ru/ )

Online Services | ... Research) IPN(Institute Physics Nuclear, Paris) ISN(Institute Science Nuclear, Grenoble) JINR(Joint Institute Nuclear Research) JUL-Spez(Institute fur Kernphysik) JYFL(University Jyvaskyla, Finland) LA(Los Alamos Science Laboratory) LBL(Lawrence Berkeley Laboratory) NEANDC(Nuclear Data Committee) ORNL(Oak Ridge National Laboratory) UTTAC(University Tsukuba Center) ZFK(Zentralinstitut fur Kernforschung) **************************************************** Other Code . ... Code: . ...

Еще в разделе: (Показать все результаты (>4920) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services

... Department . Staff . ... Ph.D. (Doctor of physico-mathematical sciences), Professor . ... Ph.D. (Candidate of physico-mathematical sciences), Associate Professor . ... Scientific secretary of the ASR Department, Ph.D. (Candidate of physico-mathematical sciences), Associate Professor . ... Ph.D. (Candidate of physico-mathematical sciences), senior researcher . ... Ph.D. (Candidate of physico-mathematical sciences), research fellow . ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>19) - ani.cmc.msu.ru/ )

... Search Pages . ... Search TWiki Variables . ... By default searches are keyword based like in a typical search engine: . ... Multiple words form an AND search, intranet web service returns all pages that have the three words anywhere in the page . ... Enclose words in double quotes to form a literal search , like "web service" . ... Stop words are excluded from a keyword search: . ... Example: To search for all topics that contain "SOAP" , "WSDL" , a literal "web service" , but not "shampoo" , . ...

Еще в разделе: (Показать все результаты (>40025) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (1 vs. 2) - TWiki
• TWikiUISearchDotPm - TWiki - TWiki - (printable)
• VarSEARCH - TWiki - TWiki - (printable)

... Объявлен 40-й конкурс научных работ молодых ученых МГУ (2015-2016 уч. г.) . Подведены итоги 39-го конкурса работ молодых ученых МГУ (2013-2014 уч. г.) . ... Подведены итоги 37-го конкурса работ молодых ученых МГУ (за 2012 г.) . Подведены итоги 36-го конкурса работ молодых ученых МГУ (за 2011 г.) . Совет молодых ученых МГУ (СМУ МГУ) является общественной организацией при Московском государственном университете имени М.В.Ломоносова и формируется из представителей различных подразделений МГУ. ...

Еще в разделе: (Показать все результаты (>2) - smu.msu.ru/ )

PHP Manual . Prev . Next . PHP 4 >= 4.0.5) notes_search -- Find notes that match keywords in database_name . string notes_search ( string database_name, string keywords) . Warning . This function is EXPERIMENTAL . The behaviour of this function, the name of this function, and anything else documented about this function may change in a future release of PHP without notice. ... This function is currently not documented, only the argument list is available. ...

Еще в разделе: (Показать все результаты (>647) - oit.cmc.msu.ru/ )

• udm_set_agent_param
• LDAP functions
• udm_add_search_limit

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>1372) - monkey.belozersky.msu.ru/ )

• About COGs