... HELP ON SCREENING OF PATTERN OR ALIGNMENT AGAINST PROTEIN PROTEIN . ... The method of looking for all pattern entries (possibly inexact) in PROTEIN databank is almost the same as in PROSITE screening procedure. ... The screening by query alignment, based on the same principle: the alignment is seen as a pattern defining letter's frequencies in every position. The pattern example: . ... the only one capital letter at a position means that only given residue should be at the position. ...

Еще в разделе: (Показать все результаты (>189) - www.genebee.msu.ru/ )

• Screening by Keyword then by Similarity
• Bioinformatics portal, Moscow State University
• Screening by similarity

... Belozersky Institute . ... BLAST at NCBI , EBI , Institute Pasteur , .. Fasta at EBI , Institute Pasteur , .. ... ClustalW at EBI , Institute Pasteur . ... SIM : pairwise alignment of protein sequences (ExPASy, Switzerland) . ... RNA analysis : mfold, RNAfold (Vienna package), tRNAscan-SE, FAStRNA; Institute Pasteur . ... Service at EMBL (Germany) . Service at EBI (United Kingdom) . Service at Institute Pasteur (France) . Service at ExPASy (Switzerland) . ... GeneBee service . ...

Еще в разделе: (Показать все результаты (>3308) - monkey.belozersky.msu.ru/ )

• HTH3_numeration_assumed
• ETS numeration assumed
• Homeodomain numeration assumed

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>25) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• StructAlign help
• ConClus

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>7282) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

Задача получить выравнивание вирусных белков, называемых "малыми дельта-антигенами", посредством программы muscle (читается "массл") и посмотреть на него в GeneDoc. ... Импортируйте файл в GeneDoc. ... Попробуйте разобраться с другими программами выравнивания, установленными на kodomo-count, а именно mafft и/или edialign . ... Посмотреть список программ пакета EMBOSS, имеющих отношения к выравниваниям, можно, выполнив команду wossname alignment Описание конкретной программы выдает программа tfm . ...

Еще в разделе: (Показать все результаты (>29612) - kodomo.fbb.msu.ru/ )

• allpy: 684ff5579345 allpy/block.py
• Help to practice 9 (multiple alignment)
• allpy: c1677c874e36 lib/allpy_pdb.py

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>3431) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - SeqPup
• SAL- Other Scientific Fields - Chemistry, Biology Related - GRS
• SAL- Other Scientific Fields - Chemistry, Biology Related - DCSE

FIRST SCREEN . Input files : image with wedges and image with spectrum (fits or tiff format). ... What to do : First of all you must fill in the region which the profiles should be taken from, by pressing "range for profiles" button. ... SECOND SCREEN . ... THIRD SCREEN . ... In the first screen you can change the size of the image by pressing "CHANGE SIZE" button. ... After pressing "Next profile" button, click to the same spectral lines in the same order as you did in the first profile. ...

Еще в разделе: (Показать все результаты (>268) - lnfm1.sai.msu.ru/ )

Scoring Matrices . Matrix Sequences Sequence Consisting of the first four Amino Acids in the Protein GYRB_ECOL: . ... Sequence Achieved by Substitution of the 2nd and 4th Amino Acid and Insertion between the 3d and 4th Amino Acid, in the Protein GYRB_ECOLI, to randomly chosen new amino acids: . ... Matrix Sequences Sequence Consisting of the First Nine Amino Acids of the Protein GYRB_ECOLI: . ... Sequence Consisting of 2nd, 3d, 7th, 8th and 9th Amino Acid Residues of the Protein GYRB_ECOLI: . ...

Еще в разделе: (Показать все результаты (>2205) - kodomo.cmm.msu.ru/ )

• Structure Alignment
• Multiple alignment
• Alignments

... Inorganic Materials Sciences . Chemistry of Coordination Compounds . Diagnostics of Inorganic Materials . Inorganic Synthesis . Inorganic Crystallochemistry . Chemistry and Physics of Semiconductor Materials . ... Phone (095) 939-14-92, Fax (095) 939-09-98, 939-55-46, E-mail: kaul@inorg.chem.msu.ru . The Synthesis of New Coordination Compounds . MOCVD Deposition of Thin Film Oxide Materials . ...

Еще в разделе: (Показать все результаты (>46) - www.inorg.chem.msu.ru/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>17) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Электронная библиотека Попечительского совета . ... Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of Liquid Crystal Devices . ... Название: Alignment Technologies and Applications of Liquid Crystal Devices . Авторы: Takatoh K., Hasegawa M., Itoh N. Аннотация: . ... Alignment Technologies and Applications of Liquid Crystal Devices demonstrates both the fundamental and practical aspects of alignment phenomena in liquid crystals. ...

Еще в разделе: (Показать все результаты (>3219) - lib.mexmat.ru/ )

• Nakamoto K. - Infrared and Raman Spectra of Inorganic and Coordination
• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Schmidt O.G. - Lateral Alignment of Epitaxial Quantum Dots :: Электронная

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>166) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>67) - num-meth.srcc.msu.ru/ )

... Chem , Russian Journal of Coordination Chemistry , Russian Journal of Coordination Chemistry / Koordinatsionnaya Khimiya показать полностью.. Russian Journal of Coordination Chemistry / Koordinatsionnaya Khimiya , Russian Journal of Coordination Chemistry/Koordinatsionnaya Khimiya, издательство Nauka/Interperiodica Publishing (Russian Federation) . ... Местоположение издательства: Russian Federation . ...

Еще в разделе: (Показать все результаты (>804) - istina.msu.ru/ )

• Coordination Chemistry Reviews - журнал | ИСТИНА - Интеллектуальная Система
• Journal of Coordination Chemistry - журнал | ИСТИНА - Интеллектуальная Система
• Journal of Economic Interaction and Coordination - журнал | ИСТИНА -

... Cartesian Shift Coordinates . ... If the process topology is a cartesian structure, a MPI_SENDRECV operation is likely to be used along a coordinate direction to perform a shift of data. ... MPI_CART_SHIFT(comm, direction, disp, rank_source, rank_dest) . ... IN direction] coordinate dimension of shift (integer) . ... Depending on the periodicity of the cartesian group in the specified coordinate direction, MPI_CART_SHIFT provides the identifiers for a circular or an end-off shift. ... Центры . ...

Еще в разделе: (Показать все результаты (>158) - www.parallel.ru/ )

• Topology inquiry functions | PARALLEL.RU - Информационно-аналитический центр по

A paint device in Qt is a drawable 2D surface. ... The default coordinate system of a paint device has its origin located at the top left position. ... It is possible to transform the coordinate system when drawing in a paint device. ... It can translate, scale, shear and rotate everything from simple lines to text and pixmaps. The following QPainter functions transform the coordinate system: . ... scale() . ... In addition, the QPixmap::xForm() function can scale, shear and rotate a pixmap. ...

Еще в разделе: (Показать все результаты (>244) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QGroupBox Class
• Linux Touch Screen HOWTO
• Qt Toolkit - QCursor Class

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>54) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>110) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

. Enter Coordinates in Deg Min Sec . DD MM SS . GPS Coordinates deg min . Decimal Degrees . Enter a Coord in Decimal Degrees: . GPS Coordinates deg min . DDMMSS DD MM SS . Enter a Coord in GPS Coords: deg min . Decimal Degrees . DDMMSS DD MM SS .

Еще в разделе: (Показать все результаты (>56) - herba.msu.ru/ )