... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>10809) - mouse.belozersky.msu.ru/ )

When sending a mail message to a user on the same system: jane . This is the address for the user jane on the same system as the person sending the mail. When sending a mail message to a user on another local system: ezax@frolix . This is the address for the user known as ezax on another local system frolix . When sending a mail message to a user on another system in another domain : helper@ubik.ed . ... This is the address for mail to the user ivan on another system, islay . ...

Еще в разделе: (Показать все результаты (>552) - comet.sai.msu.ru/ )

• Examples of sending Cc: and Bcc: copies
• Examples of inserting the contents of another file
• Example of logging in to another account

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

... О UNИX . ... Lists . ... All you do is indent the line containing the list item with at least one space. To nest lists of different levels, you use different depths of indenting. ... A numbered list, mixed with bullets: 1. one 1. two 1. one * bullet 1 * bullet 2 1. two 1. three * bullet 1. one Variations of numbered lists: * Lowercase roman i. one i. two * Uppercase roman (with start offset 42) I.#42 forty-two I. forty-three * Lowercase alpha a. one a. two * Uppercase alpha A. one A. two . ...

Еще в разделе: (Показать все результаты (>878) - uneex.lorien.cs.msu.su/ )

• Issues Regarding DNS and Apache - Apache HTTP Server
• mod_ext_filter - Apache HTTP Server

... О UNИX . ... Lists . ... All you do is indent the line containing the list item with at least one space. To nest lists of different levels, you use different depths of indenting. ... A numbered list, mixed with bullets: 1. one 1. two 1. one * bullet 1 * bullet 2 1. two 1. three * bullet 1. one Variations of numbered lists: * Lowercase roman i. one i. two * Uppercase roman (with start offset 42) I.#42 forty-two I. forty-three * Lowercase alpha a. one a. two * Uppercase alpha A. one A. two . ...

Еще в разделе: (Показать все результаты (>217) - uneex.mithril.cs.msu.su/ )

previous next contents elements attributes . ... Definitions . ... User agent . A user agent is any device that interprets HTML documents. ... User agents should continue to support deprecated elements for reasons of backward compatibility. ... An obsolete element or attribute is one for which there is no guarantee of support by a user agent. ... Element and attribute names are marked within the source HTML for the specification and may be rendered specially depending on your user agent. ...

Еще в разделе: (Показать все результаты (>581) - itpm.msu.su/ )

• Another Example
• Checking the ARP Tables
• Issues Regarding DNS and Apache - Apache HTTP Server

... Wiki . ... wiki: InterTrac . ... An InterTrac link can be seen as a scoped TracLinks . It is used for referring to a Trac resource (Wiki page, changeset, ticket, ...) located in another Trac environment. ... If the targeted Trac is running a version below тАЛ 0.10 ( тАЛ r3526 to be precise), then it doesn't know how to dispatch an InterTrac link, and it's up to the local Trac to prepare the correct link. ... trac:wiki:InterTrac тАЛ trac:wiki:InterTrac . ... trac:ticket:234 тАЛ trac:ticket:234 . ...

Еще в разделе: (Показать все результаты (>2999) - kodomo.cmm.msu.ru/ )

• InterWiki тАУ Tanchiki
• WikiFormatting ? Tanchiki

... Writing wrapper definitions . ... Wrapper definitions themselves consist of C code with special macros. ... It is suggested that all identifiers declared outside functions end with _{{fileno}}. ... forallfn fn_name}}static int {{fn_name}}_ncalls_{{fileno}}; {{endforallfn}} might expand to: . ... Use vardecl to declare variables within a wrapper definition. ... With nested wrapper definitions, this also represents the point at which to insert the code for any inner nested functions. ... Центры . ...

Еще в разделе: (Показать все результаты (>723) - www.parallel.ru/ )

• Correct use of addresses | PARALLEL.RU - Информационно-аналитический центр по
• Definitions | PARALLEL.RU - Информационно-аналитический центр по параллельным
• An Application Example | PARALLEL.RU - Информационно-аналитический центр по

This example shows how to create custom widgets with signals and slots, and how to connect them together in more complex ways. ... int value() const; public slots: void setValue( int ); signals: void valueChanged( int ); . ... Let's look at what happens when the user operates the scroll bar: The scroll bar sees that its value has changed, and emits the valueChanged() signal. That signal is connected both to the display() slot of the QLCDNumber and to the valueChanged() signal of the LCDRange. ...

Еще в разделе: (Показать все результаты (>767) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - life/life.cpp example file
• Issues Regarding DNS and Apache
• Modules

. Album : Фотоальбом Сергея Аюкова :: Travels to distant places and countries :: 1997/08 Japan (Kyoto, Nara) :: 17/08 Kyoto streets. Maruyama park . Up . << Prev . Another fine example of typical roof. Still don't know exactly what it was made of. Next >> . Created with the tool album tool from David Ljung's MarginalHacks on Wed Jun 5 20:38:35 2013 .

Еще в разделе: (Показать все результаты (>7556) - crydee.sai.msu.ru/ )

• Image: Another example of near-house decorations
• Dynamic HTML in Communicator
• Background color examples

... List Item: 3 spaces and an asterisk: < *> . ... Links to topics will be created automatically as long as you follow these simple Text Formatting Rules. ... In case you want to link to a topic in a different TWiki web write Web.TopicName , i.e. write Know.ReadmeFirst to link to ReadmeFirst located in the Know web. ... You can create a forced internal link by enclosing words in double square brackets, i.e. write [[text formatting FAQ]] to get text formatting FAQ that links to topic TextFormattingFAQ ....

Еще в разделе: (Показать все результаты (>40542) - dualopt1.cmm.msu.ru/ )

• TWikiTemplates - TWiki - TWiki

... Cheshire S., Steinberg D.H. - Zero Configuration Networking: The Definitive Guide . ... Название: Zero Configuration Networking: The Definitive Guide . Авторы: Cheshire S., Steinberg D.H. Аннотация: . ... Zero Configuration Networking: The Definitive Guide walks you through this groundbreaking network technology, with a complete description of the protocols and ways to implement network-aware applications and devices. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12784) - lib.mexmat.ru/ )

• Ramussen M. - Attractivity and Bifurcation for Nonautonomous Dynamical Systems
• Maeder R.E. - Computer science with mathematica :: Электронная библиотека
• Cabrera l.-F., Kurt C. - Web Services Architecture and Its Specifications:

Copyright 1999-2012 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI= 3 DEB_PV = 1 MY_PN = cl-${PN} MY_P= ${ MY_PN }-${PV} inherit eutils DESCRIPTION= ASDF is Another System Definition Facility for Common Lisp HOMEPAGE= http://packages.debian.org/unstable/devel/cl- asdf SRC_URI= mirror :// gentoo /${ MY_PN }_${PV}.orig.tar.gz ...

Еще в разделе: (Показать все результаты (>21701) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1485.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1485.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc7346.txt.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

This page could be summarized with the statement: don't require Apache to use DNS for any parsing of the configuration files . ... In order for Apache to function properly it absolutely needs to have two pieces of information about each virtual host: the ServerName and at least one IP address that the server responds to. ... use IP addresses in Listen . ... In any event it doesn't seem possible to reliably boot a virtual-hosted web server when DNS has failed unless IP addresses are used. ...

Еще в разделе: (Показать все результаты (>112) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache module mod_auth_anon.c
• VirtualHost Examples

nmblookup - NetBIOS over TCP/IP client used to lookup NetBIOS names . nmblookup [ -M ] [ -R ] [ -S ] [ -r ] [ -A ] [ -h ] [ -B broadcast address ] [ -U unicast address ] [ -d debuglevel ] [ -s smb config file ] [ -i NetBIOS scope ] [ -T ] name . This program is part of the Samba suite. nmblookup is used to query NetBIOS names and map them to IP addresses in a network using NetBIOS over TCP/IP queries. ... S Once the name query has returned an IP address then do a node status query as well. ...

Еще в разделе: (Показать все результаты (>957) - oit.cmc.msu.ru/ )

• Type Juggling
• imap_rfc822_write_address
• Declaring Exported Functions

... Prefered term (PT) - is the term selected among synonyms to be the one used for indexing and retrieval purposes. ... TZ uses subdictionary (should be defined in tsearch2 configuration) to normalize thesaurus text. ... For example, consider thesaurus (with simple subdictionary) rules with pattern 'swsw' ('s' designates stop-word and 'w' - known word): a one the two : swsw the one a two : swsw2 . ... Dictionary="en_stem" defines dictionary (snowball english stemmer) to use for thesaurus normalization....

Еще в разделе: (Показать все результаты (>2016) - www.sai.msu.su/ )

• GiST - Introduction
• NASA Web Site Privacy and Security Notices, Web Site Disclaimer, and
• Dictionaries

... Alignment Sequence . Include picture . No Picture Only Structure Structure and BP numbers Structure and Stem Energy Full Picture . Sequence name . Alignment OR sequence (without name). The usage of Alignment is strongly recommended. Alignment example: . ... ANMF CGCGGGGTAGAGCAGCCTGGTAGCTCGTCGGGCTCATA AQTRNF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAA BGTRF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAT ANMF ATCCTCTCCCCGCC---- AQTRNF ATCCGCCTCCCGGCACCA BGTRF ATCCGCCTCCCGGCACCA . ...

Еще в разделе: (Показать все результаты (>146) - www.genebee.msu.ru/ )

• Screening pattern or alignmemt against PROTEIN databank
• Screening by similarity
• TreeTop - Phylogenetic Tree prediction

Homepage: http://digitalbush.com/projects/masked-input-plugin . ... It allows a user to more easily enter fixed width input where you would like them to enter the data in a certain format (dates,phone numbers, etc). ... Any character not in the definitions list below is considered a mask literal. ... date").mask("99/99/9999"); $("#phone").mask("(999) 999-9999"); $("#tin").mask("99-9999999"); $("#ssn").mask("999-99-9999"); . ... This topic: System > JQueryPlugin > JQueryMaskedInput . ...

Еще в разделе: (Показать все результаты (>7088) - wiki.cmc.msu.ru/ )

• FAQAnApplicationWithWikiForm < System < Foswiki
• WikiWord < System < Foswiki

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• Input Formats