... Reserved Keys . ... The following keys are reserved. An implementation is not required to interpret these keys, but if it does interpret the key, it must provide the functionality described. { host} . Value is a hostname. The format of the hostname is determined by the implementation. { arch} . ... The format of path is determined by the implementation. { file} . ... The format of the filename and internal format of the file are determined by the implementation. { soft} . ... Центры . ...

Еще в разделе: (Показать все результаты (>559) - www.parallel.ru/ )

• Reserved Key Values | PARALLEL.RU - Информационно-аналитический центр по
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>3101) - oit.cmc.msu.ru/ )

• Hints on Running a High-Performance Web Server

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>24202) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Продам мужские джинсы Reserved (ФОТО) . ... Re: Продам мужские джинсы Reserved (ФОТО) [ re: akim ] . ... Re: Продам мужские джинсы Reserved (ФОТО) [ re: Manager ] . ...

Еще в разделе: (Показать все результаты (>4460) - www.snto-msu.net/ )

... All rights reserved finmen.spa@mail.ru : : hcp://spa.msu.ru/page_325.html : hcp://vk.com/mh_msu_fgu_finance .. ... All rights reserved / () Ї : Ї : LIBOR ( London Interbank Offered Pate), MIBOR ( Moscow Interbank Offered Pate) Ї :LIBID (London Interbank Bid), MIBID (Moscow Interbank Bid) Ї : MIACR (Moscow Interbank AcЇal Credit Rate) Ї : Prime- rate, Mosprime- rate .. ... All rights reserved Ї ґ , t i B ґ D =- - - - - - - - - - - - - - t - 360 i - , 100% Ї .. ... All rights reserved Ї , Ї APR ґ , . ...

Еще в разделе: (Показать все результаты (>26) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2702_finance_analysis.pdf
• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2002_finance_analysis.pdf

... Displays a rotating "TWiki Tip of the Day" to help familiarize new users with TWiki features. ... Initial version - Packaging by TWiki:Main.LynnwoodBrown . ... strong.tipsOfTheDayHeader - header that says "TWiki Tip of the Day" .tipsOfTheDayText - the tip; contains title and tip summary and link "Read on" .tipsOfTheDayTitle - title of the tip; the link to the tip topic . ... data/TWiki/TipsContrib.txt . ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.TipsContrib . ...

Еще в разделе: (Показать все результаты (>39469) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki - (printable)
• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (1 vs. 6) - TWiki

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow ?(?QWidget?*?parent=0, const?char?*?name=0, WFlags?f=0?)? . QWindow ?()? . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright ? 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>850) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - qpointarray.h include file
• Qt Toolkit - connect/connect.cpp example file
• Qt Free Edition License Statement

Планеты во Вселенной . Курс лекций для студентов астрономического отделения . Есть ли основания полагать, что планеты являются распространенным явлением во Вселенной? Может ли служить наша Солнечная система типичным примером или она уникальна? ... Эта странная Солнечная система . ... Так рождаются планеты? ... Отдела исследований Луны и планет: . ... к.ф.м.н. Ж.Ф.Родионова . к.ф.м.н. В.В.Бусарев . ... Карты Меркурия Ж.Ф.Родионова . ... Карты Луны Ж.Ф.Родионова . ... Луны и планет . ...

Еще в разделе: (Показать все результаты (>206) - selena.sai.msu.ru/ )

• Mikhail V. Goryachev
• Луноход1
• Отдел исследований Луны и планет

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ґ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : ? , - ?. Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>33) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Modules | Directives | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . Many of the documents on these Developer pages are lifted from Apache 1.3's documentation. ... Apache 2.0 Hook Functions . ... Converting Modules from Apache 1.3 to Apache 2.0 . ... Documenting Apache 2.0 . ... Integrating a module into the Apache build system . ... Some notes on Apache module development by Ryan Bloom . ... Licensed under the Apache License, Version 2.0 . ...

Еще в разделе: (Показать все результаты (>1866) - uneex.lorien.cs.msu.su/ )

• mod_file_cache - Apache HTTP Server
• Apache Tutorials - Apache HTTP Server
• mod_speling - Apache HTTP Server

Modules | Directives | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . ... Many of the documents on these Developer pages are lifted from Apache 1.3's documentation. ... Apache 2.0 Hook Functions . ... Converting Modules from Apache 1.3 to Apache 2.0 . ... Documenting Apache 2.0 . ... Integrating a module into the Apache build system . ... Some notes on Apache module development by Ryan Bloom . ... Licensed under the Apache License, Version 2.0 . ...

Еще в разделе: (Показать все результаты (>802) - itpm.msu.su/ )

• mod_file_cache - Apache HTTP Server
• Apache Tutorials - Apache HTTP Server
• mod_speling - Apache HTTP Server

Running Apache on a heavily loaded web server, one often encounters problems related to the machine and OS configuration. ... Quick and detailed performance tuning hints for BSD-derived systems. ... Depending on the syntactic form of the TZ environment variable, these systems have several different algorithms to determine the local time zone (presumably compatible with something). ... This form delegates the knowledge of the time zone information to an external compiled zoneinfo file ( la BSD). ...

Еще в разделе: (Показать все результаты (>133) - neptun.sai.msu.ru/ )

• Apache Tutorials
• Apache HTTP Server Version 1.3 Documentation
• Apache HOWTO documentation

... The common results (Ariel Yoshkar-Ola) will be published later Ї Pocherevin Roman (Lomonosov Moscow State University , Russia ) ґ 788 points Ї Tugova Ekaterina (Lomonosov Moscow State University , Russia ) ґ 788 points Ї Briukhova Natalia (Lomonosov Moscow State University , Russia ) ґ 742 points Ї Krasilnikov Aleksandr (Chelyabinsk State University , Russia ) ґ 645 I. Cuza University, Romania) ґ 253 points Ї Coman Florin-Alexandru (Al. ...

Еще в разделе: (Показать все результаты (>34) - new.math.msu.su/ )

... The Network Time Protocol (NTP) is used to synchronize the time of a computer client or server to another server or reference time source, such as a radio or satellite receiver or modem. ... Information on the NTP architecture, protocol and algorithms can be found in the Further Information and Bibliography page. The Building and Installing the Distribution page presents an overview of the procedures for compiling the distribution and installing it on a typical client or server. ...

Еще в разделе: (Показать все результаты (>4798) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Electrical Related Software - ACS
• Oleg Bartunov's Home Page
• SAL- Database Systems - Relational DBMS - SOLID Server

IMPORTS Dos32QuerySysState = DOSCALLS.368 rc = Dos32QuerySysState( ULONG func, /* pushed last */ ULONG arg1, ULONG pid, ULONG _res_, PVOID buf, ULONG bufsz); /* pushed first */ . it is: Dos16QprocStatus((16:16)buf,bufsz) . Dos32QuerySysState(0x17,0,0,0,(0:32)buf,bufsz); . bufsz (ULONG) . ... buf (PVOID) . buffer for returning data . res_ (ULONG) . ... pid (ULONG) . ... function code . ... 00000008 file data (see note 2 ) . ... DOSQ.C : List all data structures, linker DEF file . ...

Еще в разделе: (Показать все результаты (>4237) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Bugs found so far in XFree86/OS2 3.3
• Announcements of new WWW servers

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property ?existence? of the material point varies from ?the material point does not exist? to ?the material point exists? by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>1086) - chronos.msu.ru/ )

• Updates
• On the Institute
• Russian Interdisciplinary Temporology Seminar

News . ... Archive of News . International Conference "Biodiversity and Ecology of Parasites of Terrestrial and Water Cenoses" Moscow, Russia on 9-11 December, 2008 . ... The Conference will be held in Moscow, Russia on 9-11 December, 2008 at the Center of Parasitology of Severtsov Institute of Ecology and Evolution RAS (Leninsky Prospect 33, Moscow, Russia, 119071). ... Organizing Committee, Parasitological Conference 2008." ... A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS) ...

Еще в разделе: (Показать все результаты (>3897) - www.sevin.ru/ )

• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): Site News: Site
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News: Third
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News: XX

... This presentation is licensed for use under the terms of the Globus Toolkit Public License. ... Setting the Foundation l Strategies for the Globus Toolkit ґ Layered architecture, protocols APIs l Naming conventions ґ Functions, variables, structures, etc. l Installation tree structure ґ Where things get installed l Source tree structure ґ Where things come from March 25, 2002 Globus ToolkitTM Developer Tutorial : Basics 2 ...

Еще в разделе: (Показать все результаты (>65) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-01-Introduction1.pdf
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-05-Communication1.pdf
• http://acat02.sinp.msu.ru/accomod.html

The InterwikiPlugin links ExternalSite:Page text to external sites based on aliases defined in the InterWikis topic. ... For Foswiki and TWiki sites, both the web and the topic have to be specified: Foswiki:Webname/SomePage . ... 2001-2007, Andrea Sterbini, Peter Thoeny ( TWIKI.NET ), 2007-2012 ProjectContributor . ... Support [[Site:Page][label]] Interwiki links (PTh); use TWiki::Func interface for I18N regular expressions (Walter Mundt) . ... This topic: System > Plugins > InterwikiPlugin . ...

Еще в разделе: (Показать все результаты (>10129) - wiki.cmc.msu.ru/ )

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>5976) - kodomo.cmm.msu.ru/ )

• Term4
• Term2
• projects