... to_tsvector( [ configuration , ] document TEXT) RETURNS TSVECTOR . Parses a document into tokens, reduces the tokens to lexemes, and returns a tsvector which lists the lexemes together with their positions in the document in lexicographic order. strip( vector TSVECTOR) RETURNS TSVECTOR . ... Returns the number of lexemes stored in the vector. text ::TSVECTOR RETURNS TSVECTOR . ... The text should be formatted like the vector would be printed by the output of a SELECT . ... Query Operations ...

Еще в разделе: (Показать все результаты (>8880) - www.sai.msu.su/ )

• Query Operations
• Further Information and Bibliography
• FTS Overview

Электронная библиотека Попечительского совета . ... Gibbons J.D., Olkin I., Sobel M. - Selecting and Ordering Populations . ... Название: Selecting and Ordering Populations . Авторы: Gibbons J.D., Olkin I., Sobel M. Аннотация: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12358) - lib.mexmat.ru/ )

• M?ndez-Acosta H.O. (ed.), Femat, R. (ed.), Gonz?lez-?lvarez V. (ed.) - Selected
• Alfredo Campo E. - Selection of Polymeric Materials: How to Select Design
• Snellgrove Don - Selective Forex Trading - How to Achieve Over 100 Trades in a

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

... Форумы > Аспирантура > Тема . ... PhD position in the University of Florida . PhD position is available in the department of Industrial and Systems Engineering, University of Florida. ... Risk Management and Financial Engineering Lab website: http://www.ise.ufl.edu/rmfe/ . ... Statistical estimation in terms of factor models can be tuned to risk preferences in order to achieve better performance when applied to portfolio optimization. ... University of Florida, November 2011. ...

Еще в разделе: (Показать все результаты (>108) - www.mmonline.ru/ )

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>122) - higeom.math.msu.su/ )

Home :: Personnel :: Ivanov, Viktor Alexandrovich :: List of Publications . V.A. Ivanov, B. Jung, A.N. Semenov, I.A. Nyrkova, A.R. Khokhlov . ... P.G. Khalatur, V.A. Ivanov, N.P. Shusharina, A.R. Khokhlov . ... A.R. Khokhlov, V.A. Ivanov, N.P. Shusharina, P.G. Khalatur . ... V.A. Ivanov, A.V. Chertovich, A.A. Lazutin, N.P. Shusharina, P.G. Khalatur, A.R. Khokhlov . ... A.V. Chertovich, V.A. Ivanov, A.A. Lazutin, A.R. Khokhlov . ... A.R. Khokhlov, V.A. Ivanov, A.V. Chertovich, A.A. Lazutin . ...

Еще в разделе: (Показать все результаты (>278) - polly.phys.msu.ru/ )

• Selected publications of Kiselyova, Olga Igorevna
• Recent selected publications
• Selected publications of Kramarenko, Elena Yul'evna

... Molecular mechanisms of selective effects in the radiation chemistry of organic and polymeric systems . Abstract Physical and chemical grounds of selective effects in the radiation chemistry of molecular materials are considered. ... The role of selective effects in the radiation chemistry of macromolecules and organized polymeric systems was discussed. Moscow University Chemistry Bulletin . 2001, Vol. ... 3, P. 194 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ...

Еще в разделе: (Показать все результаты (>764) - chem.msu.ru/ )

• The anomalous behaviour of the non-selective ionisation signal pulse under
• Selected chapters of chemistry: novel promising materials
• Tatiana S. Yankova

... Drop points . ... Pick ops use the point in a set nearest to the location of the pointer when clicked to select the set for the chosen operation. ... To activate a set, select the set number, specify the number of points in the set and click on "Accept." ... Press the button marked Accept . ... Press the button marked Accept to divide the selected set into (length of selected set) / N sets with the remainder to the last set. ... Press the button marked Accept to merge all sets to the selected set. ...

Еще в разделе: (Показать все результаты (>488) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~polar/xmgr/graphops.html
• Number of accreting X-ray binaries of selected types

CD Order images | ... PhotoDisc CD titles may include low, medium, and high-res files; or low and medium-res files only. ... High Res . ... Each CD contains from 30 to 100 pictures (dependind on the resolution) scanned on the professional high-resolution scanner. ... Kamchatka . ... You can see small portion of CD's images at our collection . ... 100 images of Alexey Mazlov, who spend a 15 years filming Kamchatka from southern cape Lopatka to northern Chukotka from helicopter. ... EcoPhoto Imagery . ...

Еще в разделе: (Показать все результаты (>153) - www.fadr.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>190) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Trac supports adding custom, user-defined fields to the ticket module. ... The syntax of each field definition is: FIELD_NAME = TYPE (FIELD_NAME.OPTION = VALUE) .. The example below should help to explain the syntax. text : A simple (one line) text field. label: Descriptive label. value: Default value. order: Sort order placement. ... checkbox : A boolean value check box. label: Descriptive label. value: Default value (0 or 1). order: Sort order placement. select : Drop-down select box. ...

Еще в разделе: (Показать все результаты (>2689) - kodomo.cmm.msu.ru/ )

• TracTicketsCustomFields (diff) тАУ Tanchiki
• 1euy_script

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>101) - scon155.phys.msu.su/ )

• Off-center impurities
• Alexander I. Lebedev

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>3470) - crydee.sai.msu.ru/ )

• Solar modeling input physics (thermodynamics, opacity, nuclear reactions)
• Equation of state for solar modeling
• Flowering Layers Example

... If you have been using a tool such as the line drawing tool which does not allow you to select other objects, you can use this menu item to return to the normal selection cursor. ... This puts a colored copy of either text or a drawn object behind it. ... Your options are color , (which lets you set either a plain color or one of many gradients) Clipart (which gives a dialog box to let you find your clipart on your hard drive) or picture , which again gives a dialog box to find the picture you want....

Еще в разделе: (Показать все результаты (>460) - uneex.lorien.cs.msu.su/ )

• Тег <SELECT>
• The Data Menu
• Chapter€а7.€а Painting with GIMP

... Next: Rotation Up: Data Processing Functions (Mathematics Previous: Differential filters Contents Index . It is possible to subtract the surfaces of two types -- surface of the first order (plane), and surface of the second order. ... If you have select a surface area in advance, then there are two possible ways to fulfill an operation -- to process only the selected area (In selection), or to process the whole image by using the slope coefficients derived from the selected area (By selection). ...

Еще в разделе: (Показать все результаты (>147) - www.spm.genebee.msu.ru/ )

• Reconstruction of 3D Images
• Select surface region
• Videocameras

Bioinf ormatic analysis of diverse protein superf amilies to design improved enzymes Dmitry Suplatov , Nikolay Panin, Tatyana Shcherbakova, Ilyas Khaliullin, Vytas Svedas Lomonosov Moscow State University, Belozersky Institute of Physicochemical Biology and F aculty of Bioengineering and Bioinformatics ... D. Suplatov, E. Kirilin, V. Takhaveev, V. Svedas (2014) Zebra: web-server for bioinformatic analysis of diverse protein families, J.Biomol.Struct.Dyn., ...

Еще в разделе: (Показать все результаты (>270) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/217.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/163.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/119.pdf

... THE LJUBLJANA SUMMER SCHOOL 2006 . ... THE LJUBLJANA SUMMER SCHOOL 2006 is a new intensive programme open to both undergraduate and graduate students of Business, Economics, and other fields of Social Sciences. The programme was created at the Faculty of Economics in Ljubljana in order to impart knowledge by taking full advantage of our country s unique geographical position: the meeting point of East and West. ... The Summer School s aim is to learn by applying knowledge to real-life situations. ...

Еще в разделе: (Показать все результаты (>94) - www.mgubs.ru/ )

зарегистрированных пользователей require( ../script/config.php3 ); ////////////////////////////////begin///////////////// class cl_spisok_polz { //********************** function showdata() { if (empty($ GLOBALS [' status '])) { $s= select * from treg order by f ; } else { if ($ GLOBALS [' status ']=='ruk') {$s= select * from treg where status 0 order by status , f ;} ...

Еще в разделе: (Показать все результаты (>35) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/mikromag/catalog/catalog.php3
• Персональная страница пользователя Микромаг

PHP Manual . ... How do I create arrays in a HTML <form>? ... php echo "<textarea name=mydata>\n"; echo htmlspecialchars($data)."\n"; echo "</textarea>"; ?> ... In an URL . ... To get your <form> result sent as an array to your PHP script you name the <input>, <select> or <textarea> elements like this: . ... input name="MyArray[]"> <input name="MyArray[]"> <input name="MyOtherArray[]"> <input name="MyOtherArray[]"> This produces two arrays, MyArray and MyOtherArray, that gets sent to the PHP script. ...

Еще в разделе: (Показать все результаты (>586) - oit.cmc.msu.ru/ )

• printer_select_brush
• printer_select_pen
• printer_select_font

... Some monomer classes have the same name as per PDB database. ... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... 80 sequences . ... 86 name = lines [ 0 ] . ...

Еще в разделе: (Показать все результаты (>9262) - kodomo.fbb.msu.ru/ )

• allpy: 675b402094be lib/block.py
• allpy: 88c246f20918 sandbox/ttk.py
• cca: Interface.py diff