... 2011 October 13 . The Color of IC 1795 . ... Explanation: This sharp cosmic portrait features glowing gas and obscuring dust clouds in IC 1795, a star forming region in the northern constellation Cassiopeia . ... Not far on the sky from the famous Double Star Cluster in Perseus, IC 1795 is itself located next to IC 1805, the Heart Nebula , as part of a complex of star forming regions that lie at the edge of a large molecular cloud. ... About APOD | ... A service of: ASD at NASA / GSFC . ...

Еще в разделе: (Показать все результаты (>8961) - www.sai.msu.su/ )

• APOD: 2010 May 6 - Northern and Southern Owls
• APOD: 2006 September 7 - Colorful Moon Mosaic
• APOD: 2015 December 24 - Star Colors and Pinyon Pine

Astronomy Picture of the Day . ... 30.07.2004 . ... In the foreground, lights along the northern horizon give an orange cast to the low clouds. But far above the clouds, at altitudes of 100 kilometers or more, are alluring green and purple hues of the aurora borealis or northern lights , a glow powered by energetic particles at the edge of space. ... July 2004 . ... Publications with keywords: aurora borealis . Publications with words: aurora borealis . ... Alaska Aurora Sequence . ...

Еще в разделе: (Показать все результаты (>74674) - www.astronet.ru/ )

• Астронет > Northern Lights
• An Orion of a Different Color
• Астронет > An Orion of a Different Color

The QColorGroup class contains a group of widget colors. ... QColorGroup ?(?const?QColor?&?foreground, const?QColor?&?background, const?QColor?&?light, const?QColor?&?dark, const?QColor?&?mid, const?QColor?&?text, const?QColor?&?base?)? . ... The current widget color group is returned by QWidget::colorGroup (). ... Destroys the color group. Returns the background color of the color group. ... Returns the foreground color of the color group. ... Returns the text foreground color of the color group. ...

Еще в разделе: (Показать все результаты (>459) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QPalette Class
• Qt Toolkit - QPen Class
• Qt Toolkit - QBrush Class

... 2000 April 24 . Reflection Nebula M78 . ... Explanation: An eerie blue glow and ominous columns of dark dust highlight M78, a bright reflection nebula in the constellation of Orion . The dust not only absorbs light, but also reflects the light of several bright blue stars that formed recently in the nebula. ... M78 belongs to the larger Orion Molecular Cloud Complex that contains the Great Nebula in Orion and the Horsehead Nebula . ... About APOD | ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: June 25, 1996 - A Star Forming Region in the LMC
• APOD: April 9, 1999 - WR 104: Pinwheel Star
• APOD: 2000 August 18 - X-Rays From Antennae Galaxies

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>4389) - wiki.cmc.msu.ru/ )

• PatternSkinCss < System < Foswiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>1871) - wiki.cs.msu.ru/ )

• VarBUTTON < System < Foswiki

Questions and answers on how to customize the default look of TWiki for your own needs, using style sheets. ... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS variables in TWiki.TWikiPreferences to your new files: * Set TWIKILAYOUTURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set TWIKISTYLEURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set TWIKICOLORSURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ...

Еще в разделе: (Показать все результаты (>36710) - dualopt1.cmm.msu.ru/ )

• PatternSkinCssCookbook - TWiki - TWiki
• PatternSkinCssCookbook < TWiki < TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

... Character data . ... This section of the specification describes the basic data types that may appear as an element's content or an attribute's value. ... The syntax of valid character data in HTML is defined in terms of the SGML concepts of NAME and CDATA. ... Although the STYLE and SCRIPT elements use CDATA for their data model, for these elements, CDATA must be handled differently by user agents. ... The attribute value type "color" ( %Color ) refers to color definitions as specified in [SRGB] . ...

Еще в разделе: (Показать все результаты (>306) - itpm.msu.su/ )

This layer is defined with a <LAYER> tag. You see that the background color is applied to the rectangular region occupied by the layer. The height of the colored area is determined by the height value. This layer is defined in CSS syntax. The style definition sets the position and background color, but doesn't set any values for border characteristics. ... The style definition includes a value for border-width. ... The style definition includes a value for layer-background-color. ...

Еще в разделе: (Показать все результаты (>3361) - crydee.sai.msu.ru/ )

• Colors and backgrounds
• Dynamic HTML in Communicator
• User interface

... The color indicates how the file is affected by the changeset . [[span( style = background :#bfb;border: 1px solid # 999 ;font-size:80%;margin-right:. 5em ,`?а `)]] Green: Added \\ [[span( style = background :#f88;border: 1px solid # 999 ;font-size:80%;margin-right:. 5em ,`?а `)]] Red: Removed \\ [[span( style = background :#fd8;border: 1px solid # 999 ;font-size:80%;margin-right: ... If a region was modified, the old version is displayed above the new version. ...

Еще в разделе: (Показать все результаты (>1497) - kodomo.cmm.msu.ru/ )

• TracChangeset тАУ Tanchiki
• Ligand
• TracChangeset (diff) вАУ Tanchiki

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>182) - graphics.cs.msu.ru/ )

• Video Matting Benchmark | Graphics and Media Lab Equation Equation Equation
• Video Matting Benchmark | Лаборатория компьютерной графики и мультимедиа

Cameras Ї ґ Ї Ї Ї Ї Ї Ї Ї Ї ! MATLAB Ї MATLAB Ї Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film Ї Thin lens model: ґ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film Ї Thin ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

... The CompHEP Lagrangian tables do not describe explicitly the color structure of a vertex. ... for three color octets. ... Each vertex containing 4 color particles is split to 2 vertices which are joined by an automatically generated auxiliary field. ... Instead of evaluating this expression and that splitting all vertices independently, one can introduce one color octet auxiliary field and write this Lagrangian term as . ... enable vertex level splitting (only for vertices with 4 color particles). ...

Еще в разделе: (Показать все результаты (>559) - theory.sinp.msu.ru/ )

• [RU-NGI] request
• [RU-NGI] Different NAGIOS test results from CERN and SINP

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) ImagePSText -- To draw a text string over an image using PostScript Type1 fonts . array imagepstext ( int image, string text, int font, int size, int foreground, int background, int x, int y [, int space [, int tightness [, float angle [, int antialias_steps]]]]) . ... Foreground is the color in which the text will be painted. ... Tightness allows you to control the amount of white space between characters. ... Allowed values are 4 and 16. ...

Еще в разделе: (Показать все результаты (>328) - oit.cmc.msu.ru/ )

• ncurses_color_set
• ImageAlphaBlending
• SWFMovie->setbackground

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>110) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

Maximum Parsimony Interpretation of Chromatin Capture Experiments Dirar Homouz, Gang Chen, Andrzej Kudlicki Department of Biochemistry and Molecular Biology Institute for Translational Sciences University of Texas Medical Branch, Galveston, TX, USA The three-dimensional conformation of the genome plays an important role in gene regulation at a wide range of scales, including the distribution of the nucleosomes, the folding of chromatin , as well as chromosomal ...

Еще в разделе: (Показать все результаты (>219) - mccmb.belozersky.msu.ru/ )

psscale - Create grayscale or colorscale for maps psscale -D xpos / ypos / length / width [ h ] [ -B tickinfo ] [ -C cpt _ file ] [ -E [ length ] ] [ -I [ max _ intens ] ] [ -K ] [ -L ] [ -N dpi ] [ -O ] [ -P ] [ -U [/ dx / dy /][ label ] ] [ -V ] [ -X x - shift ] [ -Y y - shift ] [ -Z zfile ] [ -c copies ] psscale plots grayscales or colorscales on maps. Both horizontal and vertical scales are supported. ... Append h to get a horizontal scale [Default is vertical]. ...

Еще в разделе: (Показать все результаты (>490) - xray.sai.msu.ru/ )

• Nomenclature
• Galactic Gravitational Wave Background
• E-P transitions for different orbits

... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... insert ( self , * args , ** kw ) . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences . ...

Еще в разделе: (Показать все результаты (>9487) - kodomo.fbb.msu.ru/ )

• allpy: 88c246f20918 sandbox/ttk.py
• allpy: 450cbb7bcf51 sandbox/ttk.py
• allpy: 2f851b66a2c7 sandbox/ttk.py

babl: babl (pixel format translation library) babl: babl: babl is a dynamic, any to any, pixel format translation library. babl: babl: It allows converting between different methods of storing pixels known babl: as pixel formats that have with different bitdepths and other data babl: representations, color models and component permutations. babl: babl: A vocabulary to formulate new pixel formats from existing primitives is babl: provided as well as the framework to add new color models and data types. babl:

Еще в разделе: (Показать все результаты (>15930) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/dev-ruby/colorize/colorize-0.7.7.ebuild
• Index of /pub/gentoo-portage/app-misc/color/
• Index of /pub/gentoo-portage/dev-ruby/colorize/

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>371) - uneex.lorien.cs.msu.su/ )

• Chapter?а5.?а Getting images into GIMP
• Text Menu
• Справочник по CSS