... March 24, 1996 . Comet Hyakutake's Closest Approach . ... Explanation: The above true color image of Comet Hyakutake was taken the night of March 21/22. Tonight, Comet Hyakutake will make its nearest approach to Earth, closing to a mere 10 million miles as it passes over the planet's Northern Hemisphere . ... For the rest of March and most of April Comet Hyakutake will be visible to Northern viewers (weather permitting). ... Comet Hyakutake Finder Chart . ... About APOD | ...

Еще в разделе: (Показать все результаты (>8954) - www.sai.msu.su/ )

• APOD: 2005 October 30 - A Dark and Stormy Night
• APOD: 2015 January 29 - Close Encounter with M44
• APOD: 2003 October 31 - A Dark and Stormy Night

... Comet Hyakutake's Closest Approach . ... From dark sky areas, it's tail may be seen to cover about 20 degrees on the sky (40 times the apparent diameter of the full moon) corresponding to well over 3 million miles. at the distance of the comet. The word comet, referring to the tail, derives from the Greek "aster kometes", meaning long-haired star - and the hair of comet Hyakutake continues to grow as it nears the Sun! ... Hyakutake: Stars Through A Comet Tail . ... Comet Hyakutake Passes the Sun . ...

Еще в разделе: (Показать все результаты (>74111) - www.astronet.ru/ )

• Астронет > Comet Hyakutake's Closest Approach
• Messier 9 Close Up
• Comet Meets Ring Nebula: Part I

. Album : Фотоальбом Сергея Аюкова :: Travels to distant places and countries :: 1996/05 Greece, Chalkidiki :: Boat trip to Mount Athos. Peninsula governed by monks. Up . << Prev . We're getting closer; Mt. Athos is at the background. It is about 2000 meters high. Wind is cold (that's why I look so sick :-). Next >> . Photo album generated by album tool from David Madison's Marginal Hacks on Wed Jun 5 20:38:30 2013 .

Еще в разделе: (Показать все результаты (>4850) - crydee.sai.msu.ru/ )

... September 9, 1999 . Comet Hale-Bopp Over the Superstition Mountains . ... Explanation: Four years ago, Comet Hale-Bopp was discovered out near Jupiter falling toward the inner Solar System . ... Above, Comet Hale-Bopp was photographed in 1997 behind the Superstition Mountains in Arizona . Clearly visible are the comets white dust tail that shines by reflected sunlight, and the blue ion tail that shines by glowing gas. ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: December 17, 1996 - Mariner's Mercury
• APOD: December 8, 1996 - Degas Ray Crater on Mercury
• APOD: October 17, 1995 - Galaxy Dwingeloo 1 Emerges

... help . ... pair_cores/compare_aln_3d.py . ... 1.1 --- /dev/null Thu Jan 01 00:00:00 1970 +0000 1.2 +++ b/pair_cores/ compare_aln_3d.py Fri Oct 28 00:42:17 2011 +0300 1.3 @@ -0,0 +1,64 @@ 1.4 +#!/usr/bin/python 1.5 + 1.6 + import warnings 1.7 + import argparse 1.8 +from tempfile import NamedTemporaryFile 1.9 + 1.10 +from pair_cores import homology_from_3d 1.11 +from allpy .homology import MonomerHomology as MH 1.12 +from allpy .structure import CachedDownloadPdb 1.13 + 1.14 +def score...

Еще в разделе: (Показать все результаты (>34164) - kodomo.fbb.msu.ru/ )

• allpy: log

PHP Manual . ... PHP 4 >= 4.0.2) ldap_compare -- Compare value of attribute found in entry specified with DN . int ldap_compare ( int link_identifier, string dn, string attribute, string value) . ... Returns -1 on error. ldap_compare() is used to compare value of attribute to value of same attribute in LDAP directory entry specified with dn . The following example demonstrates how to check whether or not given password matches the one defined in DN specified entry. Example 1. ...

Еще в разделе: (Показать все результаты (>558) - oit.cmc.msu.ru/ )

• dbx_compare
• ldap_close
• version_compare

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>276) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/18.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/119.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

... Thabane L. - A closer look at the distribution of number needed to treat (NNT) a Bayesian approach . ... Название: A closer look at the distribution of number needed to treat (NNT) a Bayesian approach . Автор: Thabane L. Язык: . ...

Еще в разделе: (Показать все результаты (>13255) - lib.mexmat.ru/ )

• Поиск книг, содержащих Closed curve :: Электронная библиотека попечительского
• Поиск книг, содержащих Closed operator :: Электронная библиотека
• Carstensen B. - Comparing and predicting between several methods of measurement

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Price Compare Website . ... a href=http://obdevaxe.wordpress.com/>Mass Traffic Domination</a> . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4069) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: Compare Best Prices
• Экологический Форум - Фундаментальная Экология: tax of goods compared that

... We compare our results with the GRANAT X-ray observations of the Galactic center (Churazov et al. ... It is instructive to compare our results for the Galactic center starburst with what might be expected for a continuous star formation, with the average rate characteristic for the whole Galaxy. For this continuous star formation model, we would expect to observe in the region of around the Galactic center about 10% of the total number of X-ray sources in the Galaxy. ...

Еще в разделе: (Показать все результаты (>483) - xray.sai.msu.ru/ )

• Caverns in Binary Systems
• The COOC Criterion (Criterion of Observations versus Calculations)
• Galactic Gravitational Wave Background

... Closing a File . ... MPI_FILE_CLOSE(fh) . INOUT fh] file handle (handle) . int MPI_File_close(MPI_File *fh) . MPI_FILE_CLOSE(FH, IERROR) . ... void MPI::File::Close() . MPI_FILE_CLOSE first synchronizes file state (equivalent to performing an MPI_FILE_SYNC), then closes the file associated with fh. ... MPI_FILE_CLOSE is a collective routine. ... The MPI_FILE_CLOSE routine deallocates the file handle object and sets fh to MPI_FILE_NULL. ... MPI-2.0 of July 18, 1997 . ... Центры . ...

Еще в разделе: (Показать все результаты (>313) - www.parallel.ru/ )

• MPI_Group_compare | PARALLEL.RU - Информационно-аналитический центр по
• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по
• MPI_File_close | PARALLEL.RU - Информационно-аналитический центр по

... You can boot Linux either from a floppy or from the hard disk. ... When booting Linux from a floppy disk, the boot sector contains code that just reads the first few hundred blocks (depending on the actual kernel size, of course) to a predetermined place in memory. On a Linux boot floppy, there is no filesystem, the kernel is just stored in consecutive sectors, since this simplifies the boot process. ... For example, when I boot, I it looks like this: LILO boot: Loading linux. ...

Еще в разделе: (Показать все результаты (>292) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - 21 How MySQL compares to
• MySQL Reference Manual for version 3.23.10-alpha. - E Known errors and design
• The buffer cache

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>24) - mouse.genebee.msu.ru/ )

In general, homing endonucleases are meganucleases (i.e. they recognise and cut DNA sequences longer than 12 bp) encoded in various intervening sequences. ... Here we investigate the diversity of yeast intein-encoded LAGLIDADG endonucleases, and annotate their particular residues in terms of importance for DNA recognition, binding and cleavage. PFAM family PF05204 contains sequences of most of the yeast intein-encoded LAGLIDADG endonucleases. ...

Еще в разделе: (Показать все результаты (>2382) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• About COGs
• About this project

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• At closing the Congress. (With the Chief)
• Change-point synchronization in pairs of EEG channels
• Change-points in multi-channel EEG

... Previous message: [RU-NGI] Fwd: [Network-support] Closing the IPv6 Survey on October 31. The following NGIs please provide your input) . Next message: [RU-NGI] Fwd: [Network-support] Closing the IPv6 Survey on October 31. ... Is your NREN providing IPv6 connectivity [YES or NO]? ... please specify ] > > 7. ... Письмо с запросом от EGI (FYI) ================== > > -------- Original Message -------- > Subject: [Network-support] Closing the IPv6 Survey on October 31. ...

Еще в разделе: (Показать все результаты (>768) - theory.sinp.msu.ru/ )

• History and personal contributions
• [RU-NGI] EGEE-III : New requests from EC's financial services

... The bright supernova (hereafter SN) in the galaxy NGC 4527 was first sighted by S. Knight (USA) on April 13.17UT at magnitude ~14.0v. The report of the sighting was subsequently forwarded by phone to the AAVSO. ... SN 1991T. The galaxy NGC 4527 is an Sb(s)II type galaxy with an apparent Blue magnitude of 11.32 (Shapley-Ames, 1981). ... An analysis of this event utilizing visual observations by amateurs, plus a light curve is presented.. ... THE LIGHT CURVE: . ... ISN SN 1991T web page . ...

Еще в разделе: (Показать все результаты (>86) - www.rochesterastronomy.org/ )

• Supernova 1987A in LMC
• Supernova 2000C in NGC 2415
• Supernova 1999gi in NGC 3184

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>127) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>160) - www.genebee.msu.ru/ )

• DIMACS Series in Discrete Mathematics and Theoretical Computer Science Volume
• AliComp - GeneBee Alignments Comparison - Advanced
• BLAST Basic Overview

LIPSKIY-RODIONOVA' LUNAR ANTIPODES AS PRECURSORS OF A REGULAR WAVE PLANETOLOGY G.G.Kochemasov IGEM of the Russian Academy of Sciences, Moscow, Russia kochem@igem.ru / Fax: (009)(095)230 21 79 The first observations of the lunar far side allowed to compare it with the near side and draw very important conclusions in the very beginning of planetary studies based on spacecrafts. ... Celestial bodies are dichotomic. ... The concept of celestial bodies includes Sun (a star) as one of them. ...

Еще в разделе: (Показать все результаты (>92) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.pdf
• http://selena.sai.msu.ru/Pug/Publications/SSR447.pdf
• http://selena.sai.msu.ru/San/Publications/ms34/MS047.pdf