... The Great Nebula in Carina . ... Eta Carinae , the most energetic star in the nebula, was one of the brightest stars in the sky in the 1830s, but then faded dramatically. Eta Carinae is the brightest star near the image center, just left of the Keyhole Nebula . While Eta Carinae itself maybe on the verge of a supernova explosion, X-ray images indicate that much of the Great Carina Nebula has been a veritable supernova factory . Tomorrow's picture: open space . ...

Еще в разделе: (Показать все результаты (>9643) - www.sai.msu.su/ )

• APOD: 2008 August 11 - Black Hole Candidate Cygnus X-1
• APOD: 2009 November 18 - Water Discovered in Moon Shadow
• APOD: September 17, 1995 - Thousands of Coma Cluster Galaxies

... December 13, 1997 . The Coma Cluster of Galaxies . ... The Coma Cluster of Galaxies pictured is one of the densest clusters known - it contains thousands of galaxies . Each of these galaxies house billions of stars - just as our own Milky Way Galaxy does. ... In fact, the Coma Cluster is so big it takes light millions of years just to go from one side to the other! Most galaxies in Coma and other clusters are ellipticals , while most galaxies outside of clusters are spirals . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: June 9, 1999 - NGC 4414: A Telling Spiral
• APOD: 2000 January 12 - NGC 6791: An Old, Large Open Cluster
• APOD: October 18, 1999 - NGC 3603: An Active Star Cluster

... Possible Mud Volcanoes on Mars . ... 30.03.2009 . ... Credit: HiRISE , MRO , LPL (U. Arizona) , NASA Explanation: Is this a mud volcano on Mars? ... First of all, hills like this seem to better resemble mud volcanoes on Earth than lava volcanoes and impact craters on Mars. ... Infrared images from space indicate that hills like this cool more quickly than surrounding rock, consistent with a dried mud composition. ... March 2009 . ... Publications with keywords: Mars - volcano . ...

Еще в разделе: (Показать все результаты (>76011) - www.astronet.ru/ )

• XWare > APOD
• Journal "Peremennye Zvezdy"
• Huygens Discovers Luna Saturni

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>170) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Early on, our interest in chirping analysis functions was motivated by a different kind of chirping phenomenon: chirping due to perspective. ... Our interest in radar, however, drew us toward processes that are more accurately analyzed by linear-FM chirplets. ... We have also constructed other chirplet transforms, such as a three-parameter Doppler chirplet representation that models a source producing a sinusoidal wave, while moving along a straight line (e.g. a train whistle). ...

Еще в разделе: (Показать все результаты (>4582) - crydee.sai.msu.ru/ )

• "Can You Picture That"
• Moving Pictures Songlist
• Image: Picture 005

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>155) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

... It is possible to direct the immune system to attack cancer cells. This can be done because of the presence of foreign proteins inside cancer cells. ... Mutation density in cancer cells The chance of finding an immunogenic peptide among all neutral foreign peptides for a mutation-rich cancer is higher than that for a cancer with fewer mutations. ... The final step is the CD8+ cell that kills the cells showing foreign peptides on their surface. ... Calculate the processing score for each peptide. ...

Еще в разделе: (Показать все результаты (>280) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/30.pdf

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: provide the motion picture to the much fo . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>6365) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: give the motion picture to a
• Экологический Форум - Фундаментальная Экология: How For The Best Bank Card Out
• Экологический Форум - Фундаментальная Экология: Ideas To outlet Track down The

The QPicture class is a paint device that records and replays QPainter commands. ... bool? isNull ?()?const . uint? size ?()?const . const?char*? data ?()?const . ... Example of how to record a picture: QPicture pic; QPainter p; p. begin ( &pic ); // paint in picture p. drawEllipse ( 10,20, 80,70 ); // draw an ellipse p. end (); // painting done pic. save ( "drawing.pic" ); // save picture . ... Returns a pointer to the picture data. ... Returns the size of the picture data. ...

Еще в разделе: (Показать все результаты (>581) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - picture/picture.cpp example file
• Pictures of Most Widgets
• Qt Toolkit - QKeyEvent Class

... Astronomy search engine . ... PhysicsWeb Home Page . ... Sternberg Astronomical Institute . ... Astro Space Center Home Page . ... Landau Institute for Theoretical Physics . ... Astronomy and Space Physics Dept of Kiev University . ... NATIONAL RADIO ASTRONOMY OBSERVATORY Home Page . University of Hawaii - Institute for Astronomy . ... Space Telescope Science Institute Home Page . ... Sky & Telescope: The Essential Magazine of Astronomy . ... Springer LINK - Physics Online Library . ... Home . ...

Еще в разделе: (Показать все результаты (>306) - astro.uni-altai.ru/ )

Электронная библиотека Попечительского совета . ... Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs . ... Название: 99 Points of Intersection: Examples, Pictures, Proofs . Авторы: Walser H., Pedersen J. Аннотация: . ... In addition the book contains general thoughts on and examples of the points of intersection, as well as some typical methods of proving their existence. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>13311) - lib.mexmat.ru/ )

• Stauffer D., Kiang C.S., Walker G.H. - Possible symmetrization of Fisher's
• Tuxworth N. - Clothes: A Very First Picture Book :: Электронная библиотека
• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>352) - www.rochesterastronomy.org/ )

• Supernova 1998Y in NGC 2415
• Supernova 1998ey in NGC 7080

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>11) - uranus.sai.msu.ru/ )

• Tatjana Khruzina

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>100) - neptun.sai.msu.ru/ )

• How Directory, Location and Files sections work

... Contacts with DNA . ... List of conservative Hbonds of ETS domains with DNA backbone . Bond ID . ... All containing DNA, except W and X (18 of 20) . ETS-1, GABP alpha PU.1 from mouse; Elk-1, SAP-1 PDEF from human . ... All containing DNA . All proteins, for which there are structures, containing DNA . ... All containing DNA, except I (19 of 20) . ... List of conserved Hbonds of ETS domains with the DNA major groove . ... ETS-1, GABP alpha PU.1 from mouse; ETS-1, SAP-1 PDEF from human . ...

Еще в разделе: (Показать все результаты (>602) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_water_bridges
• ETS_all_contacts alignment

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . Учебные курсы лаборатории . ... Methodology of stereoscopic motion picture quality assessment . ... Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>199) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Graphics and

... He distributes these gifts in sacks (each sack can contain from 1 to n items) and puts the sacks with gifts around the Christmas tree (only the content of the sacks and their ordering on the circle around the tree are important). ... A river falling into a sea forms a delta which is a system of branches consisting of channels without inner intersections. (a) Suppose that in a given delta there are exactly n different (i.e. differing by at least one channel) routes down the stream. ...

Еще в разделе: (Показать все результаты (>2) - www.universe.msu.ru/ )

Dmitriy Mendeleev . ... Dmitry Ivanovich Mendeleev : A project of undergraduate students from School No.470 (St.Petersburg) . ... Brokhaus Online: Biography of Mendeleev in Russian . ... Original Periodic Table by Mendeleev . ... Mendeleev's "Principles of Chemistry" (4 Pts. in 2 Vols) . ... Mendeleev's house museum in the village Boblovo, Moscow region (in Russian) . Statue of Mendeleev in front of Chemistry Department at Moscow State University (from the article about Russian chemistry in Chem. ...

Еще в разделе: (Показать все результаты (>136) - www.chem.msu.ru/ )

• Immortals of science: Mendeleev

Shockwave structures in real gases: transition between shock interactions of different types in nonuniqueness solution regions" . Tarnavsky G.A. and Tarnavsky A.G. The physical aspects of nonuniqueness for the shockwave structures arising in super- and hypersonic flows are considered. The thermodynamic conditions specifying the regions of double solution are analyzed. ...

Еще в разделе: (Показать все результаты (>161) - num-meth.srcc.msu.ru/ )

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>1049) - geo.web.ru/ )

• Index of Kamchatka Pictures
• dscn1156.jpg
• dscn0292.jpg