... 2006 October 28 . Comet SWAN Outburst . ... Explanation: Near its closest approach to planet Earth, comet SWAN (C/2006 M4) brightened unexpectedly earlier this week , becoming visible to naked-eye observers under dark night skies. ... To make the picture, images totaling eight minutes in exposure time were stacked and centered on the comet as it moved relatively quickly against the background star field. ... About APOD | ... NASA Web Site Statements, Warnings, and Disclaimers . ...

Еще в разделе: (Показать все результаты (>9603) - www.sai.msu.su/ )

• APOD: 2013 October 3 - M106 Close Up
• APOD: 2012 May 3 - M106 Close Up
• APOD: March 24, 1996 - Comet Hyakutake's Closest Approach

Astronomy Picture of the Day . Discovery Image: Comet SOHO (1998 J1) . ... Credit: SOHO - LASCO Consortium , ESA , NASA Explanation: Staring at the Sun from a vantage point in space ( Kids , don't try this at home!), the Solar and Heliospheric Observatory ( SOHO ) has enabled the discovery of much about our closest star. ... While not competing with Hale-Bopp , one of SOHO's recently discovered comets has proved to be bright enough to see with the unaided eye. ... May 1998 . ... Bright Comet SOHO ...

Еще в разделе: (Показать все результаты (>75357) - www.astronet.ru/ )

• Астронет > Discovery Image: Comet SOHO (1998 J1)
• Journal "Peremennye Zvezdy"
• Saturn-Sized Worlds Discovered

Discover the cosmos! ... December 6, 1999 . M83: The Southern Pinwheel Galaxy from VLT . ... Explanation: M83 is one of the closest and brightest spiral galaxies on the sky. Visible with binoculars in the constellation of Hydra , majestic spiral arms have prompted its nickname as the Southern Pinwheel. Although discovered 250 years ago, only in this century was it appreciated that M83 was not a gas cloud but a barred spiral galaxy much like our own Milky Way Galaxy . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 March 20 - Mercury on the Horizon
• APOD: September 9, 1999 - Comet Hale Bopp Over the Superstition Mountains
• APOD: December 27, 1999 - Solar Moss

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>450) - www.rochesterastronomy.org/ )

• Supernova 2000dk in NGC 382
• Supernova 1999gi in NGC 3184
• Supernova 2001ed in NGC 706

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... On this page: . ... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS variables in TWiki.TWikiPreferences to your new files: * Set TWIKILAYOUTURL = %PUBURLPATH%/%TWIKIWEB%/YourNewTopic/layout.css * Set TWIKISTYLEURL = %PUBURLPATH%/%TWIKIWEB%/YourNewTopic/style.css * Set TWIKICOLORURL = %PUBURLPATH%/%TWIKIWEB%/YourNewTopic/colors.css . ...

Еще в разделе: (Показать все результаты (>38624) - dualopt1.cmm.msu.ru/ )

• PatternSkinCssCookbook - TWiki - TWiki - (printable)
• PatternSkinCssCookbook - TWiki - TWiki
• PatternSkinCssCookbook < TWiki < TWiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>6289) - wiki.cmc.msu.ru/ )

• PatternSkinCss < System < Foswiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>2016) - wiki.cs.msu.ru/ )

Next: Observational Zoo of Binaries Up: No Title Previous: Contents . In the early 1980s, our understanding of binary star evolution   based on the pioneer work by Paczynski (1971)[ 150 ], Tutukov and Yungelson (1973)[ 195 ], van den Heuvel and Heise (1972)[ 201 ], allowed us to construct a general evolutionary scenario   which successfully explained the genesis of well-studied normal stars and offered potential explanation for new X-ray sources discovered in space experiments. ...

Еще в разделе: (Показать все результаты (>587) - xray.sai.msu.ru/ )

• Tsiolkovskii's Paradox
• Seminars

previous next contents properties index . ... Inherited? ... inherit . ... yes . aural . ... visual . ... none | ... length> ]{1,2} | ... block-level and replaced elements . ... see individual properties . ... table' and 'inline-table' elements . ... length> <length> ? ... the value of the 'color' property . ... auto | ... positioned elements . ... table-caption' elements . ... yes, the computed value is inherited . ... all elements except non-replaced inline elements and table elements . ...

Еще в разделе: (Показать все результаты (>6052) - crydee.sai.msu.ru/ )

• Colors and backgrounds
• Image: We're getting closer; Mt. Athos is at the background. It is about 2000
• Dynamic HTML in Communicator

Электронная библиотека Попечительского совета . ... Nakamoto A., Sasanuma N. - 3-Colorable Even Embeddings on Closed Surfaces . ... Название: 3-Colorable Even Embeddings on Closed Surfaces . Авторы: Nakamoto A., Sasanuma N. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>13953) - lib.mexmat.ru/ )

• Joyce J., Moon M. - Windows Vista Plain Simple :: Электронная библиотека
• Preppernau J., Cox J. - Windows VistaT Step by Step :: Электронная библиотека
• Fritsch R., Fritsch G. - The four color theorem :: Электронная библиотека

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>51) - observ.pereplet.ru/ )

• MASTER : List of HAZARDOUS ASTEROIDS (PHA) and COMETS discovered by MASTER

... Besides their content, some Wiki processors can also accept ''parameters'', which are then given as `key=value` pairs after the processor name, on the same line. ... To control what fields show up use hidden fields input type = hidden name = col value = id / input type = hidden name = col value = summary / input type = hidden name = col value = status / input type = hidden name = ... Insert custom HTML in a wiki page. || || '''`#!htmlcomment`''' || ...

Еще в разделе: (Показать все результаты (>2567) - kodomo.cmm.msu.ru/ )

• WikiProcessors тАУ Tanchiki
• snake.py ? Python Battle
• Custom Query ? Cyclyc Cell Automata

The QColorGroup class contains a group of widget colors. ... QColorGroup ?(?const?QColor?&?foreground, const?QColor?&?background, const?QColor?&?light, const?QColor?&?dark, const?QColor?&?mid, const?QColor?&?text, const?QColor?&?base?)? . ... The current widget color group is returned by QWidget::colorGroup (). ... Destroys the color group. Returns the background color of the color group. ... Returns the foreground color of the color group. ... Returns the text foreground color of the color group. ...

Еще в разделе: (Показать все результаты (>579) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QPalette Class
• Qt Toolkit - QPen Class
• Qt Toolkit - QBrush Class

... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... insert ( self , * args , ** kw ) . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences . ...

Еще в разделе: (Показать все результаты (>36362) - kodomo.fbb.msu.ru/ )

• allpy: 36095a51e4c0 sandbox/ttk.py
• allpy: a1307c0bb030 sandbox/ttk.py
• allpy: log

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>163) - www.pereplet.ru/ )

... You can boot Linux either from a floppy or from the hard disk. ... When booting Linux from a floppy disk, the boot sector contains code that just reads the first few hundred blocks (depending on the actual kernel size, of course) to a predetermined place in memory. On a Linux boot floppy, there is no filesystem, the kernel is just stored in consecutive sectors, since this simplifies the boot process. ... For example, when I boot, I it looks like this: LILO boot: Loading linux. ...

Еще в разделе: (Показать все результаты (>391) - itpm.msu.su/ )

• Basic HTML data types

... The other approach is to somehow permit the conditional inclusion of architecture- or operating system-specific sections of the spec file. ... The %ifarch conditional is used to begin a section of the spec file that is architecture-specific. ... If a spec file contains a conditional block starting with %ifarch alpha , that block would be processed only if the build was being done on a Digital Alpha/AXP-based system. ... A %endif is used to end a conditional block of spec file statements. ...

Еще в разделе: (Показать все результаты (>509) - uneex.lorien.cs.msu.su/ )

• Chapter?а15.?а Menus
• Chapter?а5.?а Getting images into GIMP
• HelpOnFormatting - UNИX

... Message data . ... The data part of the message consists of a sequence of count values, each of the type indicated by datatype. count may be zero, in which case the data part of the message is empty. The basic datatypes that can be specified for message data values correspond to the basic datatypes of the host language. Possible values of this argument for Fortran and the corresponding Fortran types are listed below. ... Центры . ...

Еще в разделе: (Показать все результаты (>435) - www.parallel.ru/ )

• Progress | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Closing a File | PARALLEL.RU - Информационно-аналитический центр по

Cameras Ї ґ Ї Ї Ї Ї Ї Ї Ї Ї ! MATLAB Ї MATLAB Ї Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film Ї Thin lens model: ґ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film Ї Thin ...

Еще в разделе: (Показать все результаты (>12) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>142) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help