. Numerical computation in C . Some source code in C/C++ for numerical analysis program. Home Site: . ftp://ftp.usc.edu/pub/C-numanal/ . Other Links: . None . Mailing Lists/USENET News Groups: . None . User Comments: . None . SAL Home | Numerical Analysis | Source Code Repositories . Comments? SAL@KachinaTech.COM . Copyright 1995-2001 by Herng-Jeng Jou . Copyright 1997-2001 by Kachina Technologies, Inc. All rights reserved.

Еще в разделе: (Показать все результаты (>1149) - www.sai.msu.su/ )

• SAL- Numerical Analysis - Source Code Repositories - ELIB
• SAL- Numerical Analysis - Source Code Repositories - Ooura's Mathematical

... Reserved Key Values . ... The following key values are reserved. An implementation is not required to interpret these key values, but if it does interpret the key value, it must provide the functionality described. { ip_port} . ... Reserved for MPI_OPEN_PORT only). { ip_address} . ... If the address is not a valid IP address of the host on which the MPI_OPEN_PORT call is made, the results are undefined. Reserved for MPI_OPEN_PORT only). ... Центры . ...

Еще в разделе: (Показать все результаты (>669) - www.parallel.ru/ )

• Reserved Keys | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>609) - oit.cmc.msu.ru/ )

Network Working Group T. Przygienda Request for Comments: 3359 Xebeo Category: Informational August 2002 Reserved Type, Length and Value (TLV) Codepoints in Intermediate System to Intermediate System Status of this Memo This memo provides information for the Internet community. ... Przygienda Informational [Page 1] RFC 3359 Reserved TLV Codepoints in ISIS August 2002 1. ... This document will not indicate specific documents using the codepoints, nor will it resolve the sub-TLV codepoints. ...

Еще в разделе: (Показать все результаты (>21645) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc6969.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6969.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp32.txt

. Comments and discussion . Comments on the regular wave planetology . G.G. Kochemasov , IGEM of the Russian Academy of Sciences, Moscow, Russia . Comment on the International Jubilee Symposium "The Scientific Results of Space Research of the Moon" . Philip J. Stooke, Department of Geography, University of Western Ontario. Return . Department of Lunar . and Planetary Research .

Еще в разделе: (Показать все результаты (>214) - selena.sai.msu.ru/ )

• Лекции
• Mikhail V. Goryachev
• Луноход1

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ґ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : ? , - ?. Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>41) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>38555) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

... Copyright @ 2003 by Humana Press Inc. All rights of any nature whatsoever reserved. 0273-2289/03/ 109 /0001/$20.00 f I Introduction SERGEY 1 v. KAlYUZHNYI*,1 AND PETER WEIlAND2 Department of Chemical Enzymology, Chemistry Faculty, Moscow State University, 119992 Moscow, Russia ; and 2Federal Agricultural Research Centre, Institute of Technology and Biosystems Engineering, 38116 Braunschweig , Germany The series of ... The 8th FAO /SREN workshop is scheduled for 2005in Uppsala, Sweden. ...

Еще в разделе: (Показать все результаты (>158) - www.enzyme.chem.msu.ru/ )

• The Kinetic Mechanism of Formate Dehydrogenase from Bakery Yeast

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow ?(?QWidget?*?parent=0, const?char?*?name=0, WFlags?f=0?)? . QWindow ?()? . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright ? 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>784) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - biff/biff.cpp example file
• Qt Toolkit - qcollection.h include file
• Linux simple fax printer server mini-HOWTO (faxsrv-mini-HOWTO)

Московский государственный университет имени М.В.Ломоносова Основан в 1755 году . ... МГУ имени М.В.Ломоносова . ... 8 апреля 2016 года в Ломоносовском корпусе МГУ имени М.В.Ломоносова состоялась церемония награждения победителей и призеров олимпиады ?Покори Воробьевы горы!? ... 6 апреля 2016 года в МГУ состоялся очередной концерт из цикла ?Ректор Московского университета приглашает?? ... Московский государственный университет имени М.В.Ломоносова . ... Copyright 1997?2016 МГУ имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>118) - www.msu.ru/ )

... On the Institute . Status of the Institute . Institute Laboratory-Chairs . Russian Interdisciplinary Temporology Seminar . Library of Electronic Publications . ... Proceedings of the Institute . The International Society for the Study of Time . Hall of the Arts . ... Collection of temporology screen savers . Copyright ? 2001 . ... Analysis Of Meyen's Typological Concept Of Time . ... PDF file, 79.4 Kb. ...

Еще в разделе: (Показать все результаты (>1149) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• Updates
• Site map

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>3735) - kodomo.cmm.msu.ru/ )

• Term1
• Term4
• projects

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>307) - acs366.phys.msu.su/ )

... 93/06/07 @SONG: Missing Boy There was a boy I almost knew him A glance exchanged Made me feel good Leaving some signs Now a legend A dream was wrought Where thoughts were heard Where love is reserved From previous times [ chorus ] Like a dead bird in the dirt Like a rusty can on the ground I don't believe in stardom Machinery in action Full of experts Full of experts Same old order Same old order Same old ...

Еще в разделе: (Показать все результаты (>2894) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/public/XG/songs/michael_walthius/GS/dreaming.txt
• http://crydee.sai.msu.ru/ftproot/pub/rec/music/lyrics/cs-uwp/s/steele.bill/garbage
• http://crydee.sai.msu.ru/ftproot/pub/rec/music/lyrics/cs-uwp/s/shanice/lovin_you

... Naik D.C. - Inside Windows Storage: Server Storage Technologies for Windows Server 2003, Windows 2000 and Beyond . ... Название: Inside Windows Storage: Server Storage Technologies for Windows Server 2003, Windows 2000 and Beyond . ... Inside Windows Storage is the first book to provide a comprehensive look at new and emerging Microsoft storage technologies. The text begins with an overview of the enterprise storage industry and Windows Server architecture, including the Windows NT I/O subsystem. ...

Еще в разделе: (Показать все результаты (>20356) - lib.mexmat.ru/ )

• Jacobson R., Misner S. - Microsoft SQL Server 2005 Analysis Services Step by
• Wit G.W. - Loss reserving methods :: Электронная библиотека попечительского
• Thurston C.M. - Language Is Served: Games, Writing Prompts, and Other Language

NAME apachectl - Apache HTTP server control interface SYNOPSIS apachectl command [.. DESCRIPTION apachectl is a front end to the Apache HyperText Transfer Protocol (HTTP) server. It is designed to help the adminis- trator control the functioning of the Apache httpd daemon. NOTE: If your Apache installation uses non-standard paths, you will need to edit the apachectl script to set the appropriate paths to your PID file and your httpd binary. See the comments in the script for details. ...

Еще в разделе: (Показать все результаты (>133) - neptun.sai.msu.ru/ )

• Server-Wide Configuration
• Apache module mod_status
• Apache's Handler Use

... The common results (Ariel Yoshkar-Ola) will be published later Ї Pocherevin Roman (Lomonosov Moscow State University , Russia ) ґ 788 points Ї Tugova Ekaterina (Lomonosov Moscow State University , Russia ) ґ 788 points Ї Briukhova Natalia (Lomonosov Moscow State University , Russia ) ґ 742 points Ї Krasilnikov Aleksandr (Chelyabinsk State University , Russia ) ґ 645 I. Cuza University, Romania) ґ 253 points Ї Coman Florin-Alexandru (Al. ...

Еще в разделе: (Показать все результаты (>109) - new.math.msu.su/ )

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>234) - phys.msu.ru/ )

Online Troubleshooting Resources: HOWTO . ... In this section, I provide a number of links to websites that I have found useful while learning to use Linux. ... Descriptions of these programs are located at the FSF Free Software Directory where many Online Manuals may also be found. ... For example , compare the man page and online manual for the tar utility. The Free On-line Dictionary of Computing (FOLDOC) is a huge encyclopedia of computing terms and concepts, maintained by Denis Howe. ...

Еще в разделе: (Показать все результаты (>1498) - uneex.lorien.cs.msu.su/ )

• apachectl - Apache HTTP Server Control Interface - Apache HTTP Server
• dbmmanage - Manage user authentication files in DBM format - Apache HTTP Server
• SSL/TLS Strong Encryption: Compatibility - Apache HTTP Server

... GeneBee . ... Supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . ... Services . ... Some services of GeneBee are mirrored at the servers of Bri-shur project . ... Databanks screening . Sequence analysis . ... AliBee - Multiple alignment Release 3.0 . Pipeline Screening: Keyword -> Similarity . ... Screening by similarity Release 3.0 . ... Gene Expression Analysis . GEA - System for Gene Expression Analysis . ... GeneBee Group Collaboration Research . ...

Еще в разделе: (Показать все результаты (>221) - www.genebee.msu.ru/ )

• Impact Factors of Scientific Journals in 1999
• GeneBee