... Initially SAI Supernova Catalogue was presented in the form of filebased system. ... The current version of SAI Supernova Catalogue presents data on supernovae together with data on their parent galaxies. ... The main source of data for the galaxies was LEDA database. ... In some cases our data were compared with the ones from the Asiago Supernova Catalogue and from List of Supernovae at Harvard-Smithsonian Center for Astrophysics, but the compilation of our Catalogue is carried out independently. ...

Еще в разделе: (Показать все результаты (>3110) - www.sai.msu.su/ )

... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>4948) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>369) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/trugman.pdf

... LDAP is the Lightweight Directory Access Protocol, and is a protocol used to access "Directory Servers". ... Search surname entry $sr= ldap _ search ($ds, o=My Company, c=US , sn=S* ); echo Search result is .$sr. p ; echo Number of entires returned is . ldap _count_ entries ($ds,$sr). p ; echo Getting entries ... p ; $info = ldap _ get _ entries ($ds, $sr); ... ldap_get_attributes -- Get attributes from a search result entry . ... ldap_get_entries -- Get all result entries...

Еще в разделе: (Показать все результаты (>1115) - oit.cmc.msu.ru/ )

• xml_get_current_column_number
• xml_get_current_line_number
• Dealing with a Variable Number of Arguments/Optional Parameters

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>101) - npidb.belozersky.msu.ru/ )

... A modification of the PIC method with adaptive mass: the interaction of a laser pulse and a plasma" . Snytnikova T.V., Dudnikova G.I., Vshivkov V.A. A modification of the PIC method with adaptive mass is proposed. ... The work was supported by the Russian Foundation for Basic Research (projects 11тАУ01тАУ00178, 11тАУ01тАУ00249, 12тАУ01тАУ00234, and 12тАУ07тАУ00065). Keywords: PIC method, Vlasov equation, Maxwell equations, dynamical change of particle number . PDF (in Russian) (252KB) . ...

Еще в разделе: (Показать все результаты (>508) - num-meth.srcc.msu.ru/ )

• Intermittency of vector fields and natural random number generators
• Composition of infinitary structures
• A modified generalized residual method for minimization problems with errors of

Network Working Group I. Chakeres Request for Comments: 5498 CenGen Category: Standards Track March 2009 IANA Allocations for Mobile Ad Hoc Network (MANET) Protocols Status of This Memo This document specifies an Internet standards track protocol for the Internet community, and requests discussion and suggestions for improvements. ... The following well-known numbers are required: a UDP port number, an IP protocol number, and a link-local multicast group address. ... IP Protocol Number .. ...

Еще в разделе: (Показать все результаты (>61134) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5498.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc6969.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6969.txt.pdf

About BAFIZ . ... BAFIZ is a program devoted to the development of a distributed network of the knowledge and data bases for research of fundamental properties of the matter and applied nuclear physics. The project sponsored by Russian Foundation of Basic Research , RFBR reference number is 95-07-19502. ... This Page is developed at Laboratory of Computational Mathematics, . ... Last updated on 2 September 1999 . Copyright 1999 Laboratory of Computational Mathematics (DRCM) ...

Еще в разделе: (Показать все результаты (>27) - dbserv.sinp.msu.ru/ )

Databases (NSDC) of the Natural Planetary Satellites. ... NSDC: Database of astrometric observations of Natural Planetary Satellites . ... They are thoroughly looking for observations in different sources, creating their owndatabases which are then mostly inaccessible to other researchers. ... In the file "content" with explications, the reference is given to the data source as well as the bibliographic reference. ... Data sources. ... Why a specific bibliographic database for Natural satellites? ...

Еще в разделе: (Показать все результаты (>481) - lnfm1.sai.msu.ru/ )

• Rules for rough data file
• jg0024
• Manpage of FITSHDR_EXPAND

... Database : bs 1 sequences ; 4, 214 , 630 total letters Searching. done ***** No hits found ****** Database : bs Posted date: Oct 1, 2006 8:51 PM Number of letters in database : 4, 214 , 630 Number of sequences in database : 1 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 0, Extension: 0 Number of Hits to DB: 5 Number of ...

Еще в разделе: (Показать все результаты (>7191) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~phoenix/term3/resultmega2.txt
• http://kodomo.cmm.msu.ru/~sds/Supplement_materials/term3/block1/dis16_1.txt
• http://kodomo.cmm.msu.ru/~manya/term3/resmegablast.txt

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... the section called The Package Label ? Verify an Installed Package Against the RPM Database . ... Verify the Package Owning <file> Against the RPM Database . ... Verify all installed packages . ... Verify All Installed Packages Against the RPM Database . ... Verify packages belonging to group <group> . ... It would be handy if RPM did nothing more than verify that every file installed by a package actually exists on your system. ...

Еще в разделе: (Показать все результаты (>1655) - uneex.lorien.cs.msu.su/ )

• Index of /static/AltDocs_informatika2/Book2/ch_10_prolog/11_number_task
• Requirements on both unmodified and modified versions
• Manual Dependencies

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Steen S.W.P. - Mathematical Logic with Special Reference to the Natural Numbers . ... passim, see also: Arithmetic of natural numbers, Set of natural numbers . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>18290) - lib.mexmat.ru/ )

• Cohen L.W., Ehrlich G. - The Structure of the Real Number System :: Электронная
• Foy B.D., Phoenix T., Schwartz R.L. - Learning Perl :: Электронная библиотека
• Steen S.W.P. - Mathematical Logic with Special Reference to the Natural Numbers

... Protein sequences: . ... OWL : non-redundant database assembled from a number of primary sources including translations of nucleic acid sequences (Swissprot, PIR, NRL3-D and GenPept). ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering all complete protein sequences in SwissProt. ... The Genome Sequence Database: complete relational database of DNA sequences and annotation . ...

Еще в разделе: (Показать все результаты (>228) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening of pattern or alignment against PROTEIN databank
• Screening protein sequence against PROSITE databank

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>33636) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• allpy: f3358da68bcd allpy/markups.py

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• XAFS Publication Database search form

Firefly (previously known as the PC GAMESS) is a freely available ab initio and DFT computational chemistry program developed to offer high performance on Intel-compatible x86, AMD64, and EM64T processors. ... At moment, Firefly includes no more than 5% of the legacy code. ... Firefly is freely available for all main PC operating systems: Windows, Linux, and Mac OS X. Firefly supports various Windows versions including Windows 8, Windows 7, Windows Server 2008, Vista, 2003, XP, 2000, NT, and 98/Me. ...

Еще в разделе: (Показать все результаты (>103) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - TDDFT
• PC GAMESS/Firefly DOCUMENTATION - CI SINGLES

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Short Reference Image Quality Estimation Using Modified Angular Edge Coherence . ...

Еще в разделе: (Показать все результаты (>308) - graphics.cs.msu.ru/ )

• GML MatLab Camera Calibration Toolbox | Graphics and Media Lab
• GML MatLab Camera Calibration Toolbox | Лаборатория компьютерной графики и
• x264 codec improvement | Graphics and Media Lab

... Previous message: [RU-NGI] Fwd: NOTIFICATION on GGUS-Ticket-ID: # 114235 "ASSIGNED" "ROC_Russia" "Region not publishing accounting by number of cores." Next message: [RU-NGI] Fwd: NOTIFICATION on GGUS-Ticket-ID: # 114235 "ASSIGNED" "ROC_Russia" "Region not publishing accounting by number of cores." ... REFERENCE LINK: >> https://ggus.eu/index.php?mode=ticket_info&ticket_id=114235 >> SUBJECT: Region not publishing accounting by number of cores. ...

Еще в разделе: (Показать все результаты (>24644) - theory.sinp.msu.ru/ )

• [RU-NGI] Fwd: NOTIFICATION on GGUS-Ticket-ID: # 114235 "ASSIGNED" "ROC_Russia"
• Structure of LanHEP input file

. Name . Last modified . Size . Description . Parent Directory . - . hanoi.pl . 26-Sep-2011 12:35 . 316 . index.html . 26-Sep-2011 12:35 . 7.5K . max.pl . 26-Sep-2011 12:35 . 709 . Apache/2.2.16 (Debian) Server at uneex.mithril.cs.msu.su Port 80

Еще в разделе: (Показать все результаты (>1203) - uneex.mithril.cs.msu.su/ )

... We have compiled the Catalogue of extragalactic supernovae using the GCVS card catalogue. ... Doubtful (?), or rejected (-) SN 8 A1 --- RemFlag [*] The '*' indicates a remark in sn_rem.dat 10- 19 A10 --- Gal Parent galaxy designation 21- 22 I2 h RAh Right Ascension 1950 of Parent galaxy 23- 24 I2 min RAm Right Ascension 1950 (minutes) 25- 28 F4.1 s RAs Right Ascension 1950 (seconds) 29 A1 --- DE- Declination 1950 (sign) 30- 31 I2 deg DEd Declination 1950 of Parent ...

Еще в разделе: (Показать все результаты (>132) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).
• GENERAL CATALOGUE OF VARIABLE STARS