... The Great Nebula in Carina . ... Eta Carinae , the most energetic star in the nebula, was one of the brightest stars in the sky in the 1830s, but then faded dramatically. Eta Carinae is the brightest star near the image center, just left of the Keyhole Nebula . While Eta Carinae itself maybe on the verge of a supernova explosion, X-ray images indicate that much of the Great Carina Nebula has been a veritable supernova factory . Tomorrow's picture: open space . ...

Еще в разделе: (Показать все результаты (>9388) - www.sai.msu.su/ )

• APOD: 2008 June 13 - At Last GLAST
• APOD: 2002 June 20 - Bright Galaxy M81
• APOD: 2015 December 6 - A Force from Empty Space: The Casimir Effect

... Астронет | Картинка дня | ... планета Астронет | ... Астрономическая картинка дня . ... Около равноденствия магнитное поле Земли ориентировано так, что создаются благоприятные условия для взаимодействия с солнечным ветром, которое и вызывает прекрасное северное сияние. ... Полярные сияния и магнитосфера Юпитера . ... Слегка сжатое магнитное поле словно через воронку несет заряженные частицы к полюсам Юпитера, опуская их прямо в его атмосферу. ... Туманность Пузырь крупным планом . ...

Еще в разделе: (Показать все результаты (>76622) - www.astronet.ru/ )

• An Orion of a Different Color
• XWare > APOD
• A Total Solar Eclipse

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>158) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

TURNING JAPANESE as recorded by The Vapors I've got your picture Of me and you You wrote I love you I love you too I sit there staring and there's nothing else to do Oh it's in color Your hair is brown Your eyes are hazel And soft as clouds I often kiss you when there's no one else around I've got your picture , I've got your picture I'd like a million of you over myself I asked the doctor to take your ...

Еще в разделе: (Показать все результаты (>5274) - crydee.sai.msu.ru/ )

• "Can You Picture That"
• Moving Pictures Songlist
• Image: Picture 269

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>169) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. May 5, 1998 . Aurora at Midnight . Credit Copyright: J. Curtis ( U. Alaska Fairbanks ) . Explanation: What's happening behind those trees? Aurora . This picture was taken at midnight near Fairbanks , Alaska , and captures familiar trees, common clouds, and a glowing sky markedly different than a sunset . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 October 15 - Globular Cluster Omega Centauri
• APOD: January 10, 1998 - Disorder in Stephan's Quintet
• APOD: May 24, 1996 - In the Center of 30 Doradus

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>82) - neptun.sai.msu.ru/ )

... Adiantaceae . ... Aceraceae . Actinidiaceae . ... Asteraceae ( Compositae , nom. alt.) ... Brassicaceae ( Cruciferae , nom. alt.) ... Fabaceae s. l. ( Leguminosae , nom. alt.) ... Lamiaceae ( Labiatae , nom. alt.) ... Umbelliferae ( Apiaceae , nom. alter.) ... Liliaceae s. l. Poaceae ( Gramineae , nom. alt.) ... Phone/fax: 7 (095) 939-2777 . e-mail: alnus@herba.msu.ru . ... Images of living plants . ...

Еще в разделе: (Показать все результаты (>347) - herba.msu.ru/ )

• Pictures of the invertebrates
• The variability of different Drosera

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>523) - rtm-cs.sinp.msu.ru/ )

• Pictures of Most Widgets
• Qt Toolkit - QPicture Class

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: give the motion picture to the a great de . ... Within the summertime time, the cheap oakley m frame sunglasses have improve to get the needed stylish parts,such as low-cost Oakley sun shades which make world's enormous vogue.It truly is genuinely so wonderful to decorate during the Most recent layout oakley sun shades to become the top quantity one fashion item. ...

Еще в разделе: (Показать все результаты (>5468) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: provide the motion picture to
• Экологический Форум - Фундаментальная Экология: give the motion picture to a
• Экологический Форум - Фундаментальная Экология: provide the motion picture to a

Электронная библиотека Попечительского совета . ... Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs . ... Название: 99 Points of Intersection: Examples, Pictures, Proofs . Авторы: Walser H., Pedersen J. Аннотация: . ... In addition the book contains general thoughts on and examples of the points of intersection, as well as some typical methods of proving their existence. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10760) - lib.mexmat.ru/ )

• Tuxworth N. - Clothes: A Very First Picture Book :: Электронная библиотека
• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная
• Поиск книг, содержащих picture (окружение) :: Электронная библиотека

Norwegian Libraries: . ... ARLIS - Kunstbib: Norwegian Art History Bibliography. ... The Norwegian Museum of Architecture . ... Art Museums . ... Henie-Onstad Art Center - Hovikodden: Norway's first Museum of Fine Arts on Internet. The Astrup Fearnley Museum of Modern Art . ... National Museum of American Art . Dallas Museum of Art . ... Electra '96 Henie Onstad Art Center's Project for Electronic Media. ... WWW-Library: History of Art . ... News: rec.fine.arts . ... News: k12.ed.art . ...

Еще в разделе: (Показать все результаты (>9) - www.hist.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

... Photos and pictures at Archives.gov . ... Escher Art Collection . ... International Art Science . ... Earth Observatory image news index . ... Moscow: administration, culture, education.. ... Fluid Dynamics Pictures of the Week Collection . Sites With Pictures and Movies of Fluids also you can look at the interesting High-Speed Photographs . ... Moscow day by day . ... old maps of Moscow . ... Crimea . Crimea MAP (clickable) . Surfing Santa Cruz . On-line pictures: . ...

Еще в разделе: (Показать все результаты (>18) - astrometric.sai.msu.ru/ )

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>203) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Лаборатория
• Smart removal of blocking effects from video | Лаборатория компьютерной графики
• Smart removal of blocking effects from video | Graphics and Media Lab

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>1112) - geo.web.ru/ )

• Index of Kamchatka Pictures
• dscn1156.jpg
• dscn0292.jpg

... Главная -> Фильмы -> The Picture of Dorian Gray . ... Фильмы . ... The Picture of Dorian Gray . ... George Sanders . ... Harry Adams . ... Harry Allen . Jimmy Aubrey . ... George Broughton . ... Jimmy Conlin . ... Herbert Evans . Rex Evans . ... Dorothy Ford . Lloyd Ford . ...

Еще в разделе: (Показать все результаты (>1031) - kinfo.ru/ )

• Team Picture - Фильмы - Kinfo.ru
• Picture Perfect - Фильмы - Kinfo.ru
• The Big Picture - Фильмы - Kinfo.ru

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>244) - lnfm1.sai.msu.ru/ )

• IDL programs
• Russian SETI

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>12) - uranus.sai.msu.ru/ )

... Figure 6.1: Example of the CompHEP menu . Figure 6.2: Example of the Fortran menu . Figure 6.3: Example of the CompHEP tables . Figure 6.4: Example of the CompHEP diagram images . Figure 6.5: Menu scheme for the symbolic session . Figure 6.6: Example of the process input . Figure 6.7: Example of the plot image . Figure 6.8: Menu scheme for the numerical session . ... Figure 6.10: Plot for a 2- 2 process . Figure 6.11: Example of pseudo-graphic diagram image . ...

Еще в разделе: (Показать все результаты (>1811) - theory.sinp.msu.ru/ )

• QFTHEP'2000-Pictures
• staff:kryukov:funny [THEP]