... Войти в систему . ... Journal of Applied Physics , Japanese Journal of Applied Physics показать полностью.. Japanese Journal of Appl. Phys , Japanese Journal of Applied Physics, Part 1: Regular Papers & Short Notes , Japanese journal of applied physics . Издательство: Institute of Pure and Applied Physics . ... Goto T. , Honda M. , Kulinich S.A. , Shimizu Y. , Ito T. в журнале Japanese Journal of Applied Physics , издательство Institute of Pure and Applied Physics (Japan) , том 54, ? ...

Еще в разделе: (Показать все результаты (>644) - istina.msu.ru/ )

• Japanese Journal of Bacteriology - журнал | ИСТИНА - Интеллектуальная Система
• Neuropathology : official journal of the Japanese Society of Neuropathology -
• Japanese Journal of Medical Mycology - журнал | ИСТИНА - Интеллектуальная

Japanese Art and Architecture , works of art produced in Japan from the beginnings of human habitation there, sometime in the 10th millennium BC, to the present. ... In the 9th century, as the Japanese began to turn away from China and develop indigenous forms of expression, the secular arts became increasingly important; until the late 15th century, both religious and secular arts flourished. ... Painting is the preferred artistic expression in Japan, practiced by amateur and professional alike. ...

Еще в разделе: (Показать все результаты (>222) - www.sai.msu.su/ )

• Tsearch2 in Japanese
• WebMuseum: Japanese Prehistory
• CGFA- Lillian Genth: Woman with a Japanese Lantern

Электронная библиотека Попечительского совета . ... Steve N. - Japanese Candlestick Charting Techniques . ... Название: Japanese Candlestick Charting Techniques . Автор: Steve N. Аннотация: . ... It includes hundreds of examples that span the equity, futures, fixed-income, and foreign exchange markets and shows how candlestick charting techniques can be used in almost any market. ... New techniques and strategies . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9699) - lib.mexmat.ru/ )

• Nison S. - Japanese Candlestick Charting Techniques: A Contemporary Guide to
• Yakuji Nippo Ltd - The Japanese Pharmacopoeia :: Электронная библиотека
• Yana A., Ooki R., Komatsu Y. - Writing E-mails in Japanese :: Электронная

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рейтинг: 12 . Japanese and Korean stars ^^ . ... Star . ... Re: Japanese and Korean stars ^^ [ re: lehainamt ] . ... Re: Japanese and Korean stars ^^ [ re: Star ] . ...

Еще в разделе: (Показать все результаты (>914) - www.fds-net.ru/ )

... Главная -> Фильмы -> Japanese Story . ... Фильмы . ... Japanese Story . ... Австралия 2003 . ... Koji Kioka . ... Сэнди, молодой геолог, вынуждена сопровождать японского бизнесмена Хиромицу вљего поездке пољАвстралии. ... Ониљмогут спастись, если будут действовать сообща, нољесть одна проблема: Сэнди иљХиромицу ненавидят друг друга.Он резок, необщителен иљсмотрит наљженщин свысока, какљмногие японские мужчины, она, наљего взгляд, слишком шумная, грубая иљагрессивная, какљмногие западные женщины. ...

Еще в разделе: (Показать все результаты (>59) - kinfo.ru/ )

• I Survived a Japanese Game S.. - Фильмы - Kinfo.ru
• Go-Con. Japanese Love Culture - Фильмы - Kinfo.ru
• Japanese Story (Японская история) [2003] - Фильм - Фильмы - Kinfo.ru

. Album : asv-album :: Travels to distant places and countries :: 1997/08 Kyoto, Nara (Japan) :: 25/08 Kyoto Botanical Garden . Up . << Prev . Model of the typical Japanese garden. Almost all details are present: moss, rocks, trees, stone lanterns, bamboo fence. Only pond is missing. Next >> . Album created by album a free tool by David Ljung on Tue Jun 23 14:46:26 2015 .

Еще в разделе: (Показать все результаты (>456) - crydee.sai.msu.ru/ )

• Image: True Japanese :-)
• Image: Japanese mountains look wild, but in reality almost everything is
• Image: Castle garden. Typical Japanese combination: pond, rocks, trees, moss.

... 21 и 22 сентября 2010 года в Токио пройдет 2-ая российско-японская конференция ?The 2nd Russian-Japanese Young Scientists Conference on NanoMaterials and NanoTechnology?. Семинар организуется Токийским институтом технологий (TokyoTech) совместно с компанией Токио-Боеки и НОЦ МГУ. ...

Еще в разделе: (Показать все результаты (>4) - nano.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Japanese jewelry years. will the world?s . ... a href=http://hermeshandbagsby.webs.com/><b>Hermes Outlet</b></a> It can be actually surprisingly effortless for everybody to discover out if maybe the Celine handbags are without a doubt accurate or even not really by just taking a take a look at the actual equipment.. ...

Еще в разделе: (Показать все результаты (>1615) - www.sevin.ru/ )

• ОБН РАН.Каталог журналов
• ОБН РАН. Каталог журналов

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 19:02:01 . 2.4K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 8.6K . application/octet-stream . Manifest . 2016-Jan-25 19:02:01 . 2.6K . application/octet-stream . metadata.xml . 2016-Jan-25 02:06:09 . 0.4K . text/xml . texlive-documentation-japanese-2012.ebuild . 2015-Aug-09 03:38:18 . 0.6K . text/plain . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>6350) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/app-i18n/tegaki-zinnia-japanese/

... View r4 > r3 > r2 > r1 . ... WabiSabi 4 - 2002-05-10 - PeterThoeny . ... Since wabi-sabi represents a comprehensive Japanese world view or aesthetic system, it is difficult to explain precisely in western terms. According to Leonard Koren, wabi-sabi is the most conspicuous and characteristic feature of what we think of as traditional Japanese beauty and it "occupies roughly the same position in the Japanese pantheon of aesthetic values as do the Greek ideals of beauty and perfection in the West." ...

Еще в разделе: (Показать все результаты (>9774) - dualopt1.cmm.msu.ru/ )

• WabiSabi - TWiki - TWiki
• WabiSabi - TWiki - TWiki - (printable)

Mustela . On a taxonomic position of the weasel (Carnivora, Mustela ) from the Cheju Island (South Korea) . ... The weasel from Cheju Island (formerly в?' Quelpart Island), which is situated in Korean Strait south of the coast of South Korea, was described as a separate species Lutreola quelpartis Thomas, 1908. ... Abramov A.V. 2000b. The taxonomic status of the Japanese weasel, Mustela itatsi (Carnivora, Mustelidae) // Zoologicheskii Zhurnal. ... A Pictorial Guide to the Mammals of Japan. ...

Еще в разделе: (Показать все результаты (>1578) - zmmu.msu.ru/ )

• Comparative skull morphology of two pika species (Ochotona princeps and O.
• Pipistrellus abramus
• A preliminary study on molecular phylogeny of giant flying squirrels, genus

... December 10, 2003 . ... Most of the students of the Russian language centre don't leave Moscow for Christmas holidays, they prefere to stay in Russia to celebrate this wonderful hoiday, to see how much beautiful it is in the Russian capitol. (more.. 10.12.2003 . Japanese passions. The 37th festival of the Japanese cinematograph had been opened from the 1st to the 7th of December in Saint-Petersburg. ... How to become immortal? ... Russian proverbs and sayings about Russian language: . ...

Еще в разделе: (Показать все результаты (>3) - www.rlcentre.com/ )

Главная О Школе СМИ о нас . Japanese Expert Takes a Stab at Moscow Traffic . ... Former Japanese Prime Minister Yukio Hatoyama faced the prospect of being stuck in Moscow rush-hour traffic perhaps for hours after his plane landed late at Domodedovo Airport. ... The presentation of a new book by Hatoyama's son on how to solve Moscow's traffic jams. The book, "Moscow: Traffic Problems of a Megalopolis," does not suggest a police escort as a solution to the city's cataclysmic traffic problems. ...

Еще в разделе: (Показать все результаты (>35) - www.mgubs.ru/ )

sp|Q81842|SHDAG_HDVP1 Small delta antigen OS= Hepatitis delta virus genotype III ( isolate Peru-1) PE=2 SV=2 MSQTVARLTSKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLLRR KKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGGKH LSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPFSR TGEGIDIRGTQQFP sp|P25882|SHDAG_HDVM2 Small delta antigen OS= Hepatitis delta virus genotype I ( ...

Еще в разделе: (Показать все результаты (>188) - kodomo.cmm.msu.ru/ )

• TracUnicode т?? Tanchiki

... PHP 4 >= 4.0.6) mb_language -- Set/Get current language . string mb_language ( [string language]) . ... If language is omitted, it returns current language as string. language setting is used for encoding e-mail messages. Valid languages are "Japanese", "ja","English","en" and "uni" (UTF-8). mb_send_mail() uses this setting to encode e-mail. Language and its setting is ISO-2022-JP/Base64 for Japanese, UTF-8/Base64 for uni, ISO-8859-1/quoted printable for English. ...

Еще в разделе: (Показать все результаты (>23) - oit.cmc.msu.ru/ )

• Multi-Byte String Functions
• mb_convert_kana

The CompHEP project was supported by . ... Japanese companies KASUMI Co, Ltd. and SECOM Co, Ltd.; ... During a long time the CompHEP group had not got a possibility to develop the project on UNIX workstations in Russia. ... We very much appreciate this support and are grateful for cooperation to our foreign colleagues Y. Shimizu, (KEK, Japan), H.S. Song (Seoul National University, Korea), O. Eboli (University of Sao Paulo, Brazil), H.-J. Schreiber (DESY, Germany). ...

Еще в разделе: (Показать все результаты (>1872) - theory.sinp.msu.ru/ )

Since wabi-sabi represents a comprehensive Japanese world view or aesthetic system, it is difficult to explain precisely in western terms. According to Leonard Koren, wabi-sabi is the most conspicuous and characteristic feature of what we think of as traditional Japanese beauty and it "occupies roughly the same position in the Japanese pantheon of aesthetic values as do the Greek ideals of beauty and perfection in the West." ... All things are imperfect . ... Copyright by the contributing authors. ...

Еще в разделе: (Показать все результаты (>338) - wiki.cmc.msu.ru/ )

Japan Student Services Organization (JASSO) Student Exchange Support Program Scholarship for Short-term Study in Japan [as of January 2016] This scholarship is available for qualified international students who are accepted by Japanese universities under student exchange agreements on a short-term basis. ... 7) Students who have a minimum GPA of 2.30 / 3.00 as calculated using JASSO's GPA calculation method shown below, based on a transcript from the previous academic year. ...

Еще в разделе: (Показать все результаты (>28) - phys.msu.ru/ )

• http://phys.msu.su/rus/international/intl-collaboration-agrmnts/docs/TUJP2016_Leaflet.pdf
• http://phys.msu.su/rus/about/structure/admin/OTDEL-FOREIGN/INVITATIONS/StudForum_Program.doc

. Hobbies: . travelling . music, piano playing, jazz . japanese language and culture . sports: weightlifting, basketball, aikido . photography, video, movie editing . Music: . Jazz, mainstream: Bill Evans , Oscar Peterson , Count Basie , Frank Sinatra , Paul Anka , Tony Bennett . Blues: Ray Charles . Modern jazz: Eliane Elias , Gregg Karukas , Jeff Kashiwa , Stacey Kent . Latin: Joao Donato . Japanese: Hikaru Utada . Miscellaneous: . Member of the Royal North Cape Club, Norway .

Еще в разделе: (Показать все результаты (>28) - polly.phys.msu.ru/ )

• Kozhunova Elena

Еще в разделе: (Показать все результаты (>78) - www.philol.msu.ru/ )