Поиск по:www.genebee.msu.ru -
Поискать по всем серверам
На этой странице приведены все страницы сервера www.genebee.msu.ru ,которые мы индексируем. Показаны документы 301 - 320 из 363.
Упорядочить по:
URL
|
дате изменения
301. TreeTop - Phylogenetic Tree prediction
... TreeTop - Phylogenetic Tree Prediction . The source sequence multiple alignment could be formed from low and upper case letters. Upper case letters will show that there is a homology between correspondent fragments in alignment. ... Tree and Picture Options . Extra tree format . None Phylip Phylip (multiline) Nexus Nexus (TREES block only) Hennig86 . ... None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... Alignment . Alignment example: . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/phtree_reduced.html -- 7.4 Кб -- 16.06.2001
Похожие документы
Похожие документы
302. Notes on searching by similarity
... The approach for estimation of the homology search program sensitivity in nucleotide case was proposed in paper I.Anderson, A.Brass , "Searching DNA databases for similarities to DNA sequences: when is a match significant?" ... Seven sequences were chosen to have length varying from 100 to 1000 bp. ... Each of the 1000 artificially evolved sequences was used as a query for database search with Genebee search, blast-2.0.8 and fasta-3.3 as search engine. ... Sequence length . ... 100 . ... Blast 2.0 ....
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/hlp/compar.html -- 7.2 Кб -- 04.06.2001
Похожие документы
Похожие документы
303. OUTPUT
... Submitted Sequences: . ... Results 1.REFINED ALIGNMENT Power 4.27 Homology percent 5.3 Symbols used in the alighnment charts: ' ' - average weight of column pair exchanges is less than weight matrix mean value '.' - is less than mean value plus one SD '+' - is less than mean value plus two SD '*' - is greater than mean value plus two SD .. ... SQ1 ( 48) yhtcggillnSHWVLTAAHCFKNKkkvt SQ2 ( 46) srqtfsirsiSQNGYDPRQNLNDVL--- SQ3 ( 1) ----------SRRTYTLTDYLKSTFr-- 5TH LOCAL SUPERMOTIF, power 2.51 + *.. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/Ma-res.html -- 10.2 Кб -- 30.05.2001
Похожие документы
Похожие документы
304. GeneBee service
. Homepage . Belozersky Institute . GeneBee . Russian EMBnet Node . Conferences in Bioinformatics and Related Disciplines . Conferences list of the Human Genome Mapping Project Hinxton, UK . Conferences list of the Human Genome Research Centre Evry, FRANCE .
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/confer/conf.html -- 2.9 Кб -- 30.05.2001
Похожие документы
Похожие документы
305. Screening protein sequence against PROSITE databank
. Homepage . Belozersky Institute . GeneBee . Russian EMBnet Node . Screening protein sequence against PROSITE databank . Help . References . Your E-mail address . Query sequence name . Sophisticated Version . Query sequence (without name) . Last updated - August 14, 2000. Any comments or suggestions are welcomed at: nik@genebee.msu.su
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/prosite_reduced.html -- 4.1 Кб -- 23.05.2001
Похожие документы
Похожие документы
306. Screening protein sequence against PROSITE databank
. Homepage . Belozersky Institute . GeneBee . Russian EMBnet Node . Screening protein sequence against PROSITE databank . Help . References . Simple Version . Minimum Helix Length . Mean Increment . Maximum Homology Percent . DotHelix Threshold . Number of Best Fragments . Gap Penalty . Your E-mail address . Query sequence name . Query sequence (without name) . Last updated - August 14, 2000. Any comments or suggestions are welcomed at: nik@genebee.msu.su
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/prosite_full.html -- 5.1 Кб -- 23.05.2001
Похожие документы
Похожие документы
307. Screening pattern or alignmemt against PROTEIN databank
... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/pat_reduced.html -- 6.0 Кб -- 23.05.2001
Похожие документы
Похожие документы
308. Screening pattern or alignmemt against PROTEIN databank
... Screening pattern or alignment against protein databank . ... SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Unitary Dayhoff Blosum 30 Blosum 50 Blosum 62 Johnson . ... Pattern Alignment . Pattern (or alignment) . Pattern example 1: . ... FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/pat_full.html -- 7.4 Кб -- 23.05.2001
Похожие документы
Похожие документы
309. http://www.genebee.msu.ru/anb/ZALESOVA.DEP/D1.HTM
DEPARTMENT OF SCIENTIFIC INFORMATION . ZOYA G. ZALESOVA . ... Belikova,M.P., Zaslesova, Z.G. Studies on citation of some branches of molecular biology and bioorganic chemistry. ... Zalesova Z.G. Citation of publications on "Bacteriorodopsin" project. ... Gus'kova L.I., Zalesova Z.G. Citation index and informational flow in biochemistry. ... Gus'kova, L.I., Markusova, V.A., Zalesova Z.G. Contribution of A. N. Belozersky Institute of Physico-Chemical Biology (MSU) in the world informational flow. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/anb/ZALESOVA.DEP/D1.HTM -- 3.9 Кб -- 17.05.2001
Похожие документы
Похожие документы
310. ГРАНТЫ
... Russian EMBnet Node . ... www.msu.ru/russian/inside/etis/int/intas.html#1 . ... National Science Foundation . ... www.agir.ru/grants/sprav/095a.html#global . ... www.agir.ru/grants/sprav/021a.html#global . ... www.agir.ru/grants/sprav/111a.html#global . ... www.agir.ru/grants/sprav/122a.html#global . ... www.agir.ru/grants/sprav/135a.html#global . ... www.agir.ru/grants/sprav/138a.html#global . ... www.agir.ru/grants/sprav/144a.html#global . ... www.agir.ru/grants/sprav/179a.html#global . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/grants.html -- 14.6 Кб -- 17.05.2001
Похожие документы
Похожие документы
311. GCG
GCG и WHAT IF в России . С 1998 года российские исследователи получили возможность использовать программные пакеты GCG и WhatIf. GCG (синоним - Wisconsin Package) представляет собой один из наиболее популярных пакетов программ для анализа биологических последовательностей (т.е. первичных структур ДНК, РНК и белков). Пакет содержит средства, позволяющие: . ... WhatIf - это пакет, предназначенный для моделирования трехмерных структур белков. ... Пакет GCG . Пакет WhatIf . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/gcg.html -- 4.8 Кб -- 17.05.2001
Похожие документы
Похожие документы
312. Ann-html
. M.V. Lomonosov Moscow State University . A.N. Belozersky Institute . of Physico-Chemical Biology . ANNUAL REPORT . 2000 . CONTENT . I. Bioenergetics and photosynthesis . II. Cell biology and physiology . III. Enzymology . IV. Gene structure, regulation and evolution . V. Molecular virology . GeneBee-server of Russian EMBnet node . I. BIOENERGETICS AND PHOTOSYNTHESIS . Generation of Transmembrane Electrical Potential during NADH Oxidation via the External Pathway and the Fatty Acid Uncoupling Effect after
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/ann2000.html -- 144.7 Кб -- 05.05.2001
Похожие документы
Похожие документы
313. NCBI BLAST Advanced Options
Options . ... Default . ... Integer . ... Threshold for extending hits, default if zero . ... Word size, default if zero . ... Effective length of the database (use zero for the real size) . ... Number of best hits from a region to keep . ... Length of region used to judge hits . ... Real . ... Effective length of the search space (use zero for the real size) ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/blast/full_options.html -- 3.2 Кб -- 09.04.2001
Похожие документы
Похожие документы
314. http://www.genebee.msu.ru/anb/BARATOVA.DEP/
DEPARTMENT OF CHROMATOGRAPHY . ... Department of chromatography as scientific and methodical department of Institute provides support of chromatography stages in the investigations of macromolecules and their fragments, which are carried out at the Institute. ... Goldanskii V.I., Kashirin I.A., Shishkov A.V., Baratova L.A.,Grebenchshikov N.I. The use of thermally activated tritium atoms for structural-biological investigation: the topography of the TMV protein- accessible surface of the virus. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/anb/BARATOVA.DEP/ -- 3.9 Кб -- 26.02.2001
Похожие документы
Похожие документы
315. Databases
... Protein sequences: . ... OWL : non-redundant database assembled from a number of primary sources including translations of nucleic acid sequences (Swissprot, PIR, NRL3-D and GenPept). ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering all complete protein sequences in SwissProt. ... The Genome Sequence Database: complete relational database of DNA sequences and annotation . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/mbdb.html -- 11.8 Кб -- 21.01.2001
Похожие документы
Похожие документы
316. LMI abstracts
Laboratory of Molecular Immunology . Grant support: . Cancer Research Institute colon cancer initiative (principal investigator S.A.Nedospasov) . Howard Hughes Medical Institute International Proram in Infectious Diseases and Parasitology (this grant is administered through Engelhardt Institute of Molecular Biology, principal investigator S.A.Nedospasov) . Our work on Serex has been funded by the Ludwig Institute for Cancer Research . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/anb/molimm/grants.htm -- 3.0 Кб -- 08.01.2001
Похожие документы
Похожие документы
317. http://www.genebee.msu.ru/embl.html
... Sequence entry X56734 (1) has been retrieved from the EMBL Database (2) and showed significant sequence similarity to .. ... accession numbers 44649 2 FTABLE.TXT Feature Table Documentation 465 3 RELNOTES.TXT Release Notes (this document) 915 4 SUBFORM.TXT Data Submission Form 418 5 SUBINFO.TXT Data Submission Documentation 333 6 UPDATE.TXT Data Update Form 107 7 USRMAN.TXT User Manual 1469 8 ACNUMBER.NDX Accession Number Index 8372365 9 CITATION.NDX Citation Index 1872434 ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/embl.html -- 41.3 Кб -- 16.10.2000
Похожие документы
Похожие документы
318. http://www.genebee.msu.ru/cmm/varta.html
Project leader: Professor A.B.Vartapetian D.Sc., ... Prof. Nina V. Chichkova, Ph.D., Senior Research Scientist Alexandra G. Evstafieva, Ph.D., Senior Research Scientist Ruben N. Karapetian, Graduate Student Yuri P. Rubtsov, Ph.D., Research Scientist Vitaly R. Shakulov, Graduate Student Brief project description: Substantial evidence indicates that cell division and cell death, although seemingly opposing, are tightly linked. ... Recent publications (2000): 1. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/cmm/varta.html -- 4.0 Кб -- 12.10.2000
Похожие документы
Похожие документы
319. Center of Molecular Medicine
... Russian EMBnet Node . ... a potential marker of small cell lung carcinoma. Project leader: Professor P.P.Philippov. Mitochonria in TNF-induced apoptosis: potential target . for optimization of anti-cancer therapy and treatment of TNF-dependent . ... Project leader: Member of Russian Academy of Sciences V.P.Skulachev . ... Project leader: Professor S.A.Nedospasov . Role of prothymosin a in cancer development, apoptosis, and immune response. Project leader: Professor A.B.Vartapetian ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/cmm/ludwig.html -- 3.7 Кб -- 12.10.2000
Похожие документы
Похожие документы
320. -:?'? ??':?''????% ?:'?-??'
... Russian EMBnet Node . ... a potential marker of small cell lung carcinoma. Project leader: Professor P.P.Philippov. Mitochonria in TNF-induced apoptosis: potential target . for optimization of anti-cancer therapy and treatment of TNF-dependent . ... Project leader: Member of Russian Academy of Sciences V.P.Skulachev . ... Project leader: Professor S.A.Nedospasov . Role of prothymosin a in cancer development, apoptosis, and immune response. Project leader: Professor A.B.Vartapetian ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/cmm/ludwig_r.html -- 3.7 Кб -- 12.10.2000
Похожие документы
Похожие документы