Поиск по:mouse.genebee.msu.ru -
Поискать по всем серверам
На этой странице приведены все страницы сервера mouse.genebee.msu.ru ,которые мы индексируем. Показаны документы 41 - 60 из 63.
Упорядочить по:
URL
|
дате изменения
41. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex3/nhunt-3.out
Nhunt 1.5.6.2 [May-16-2011] Length of query file: 125 bp Length of database file: 5419036 bp lambda = 0.204 Number Sequences producing significant alignments: Score E-value 1 CP001176 99.2 0.118707 2 CP001176 98.1 0.148253 3 CP001176 90.4 0.708939 Alignment 1: misc_240777 from 20 to 105, CP001176 from 503063 to 503146 Initial score: 101.6 (33.1 bits), adjusted score: 99.17 (32.4 bits), E-value: 0.118707 Identity = 53/86 (62%) Strand: Plus/Plus Compositional adjustment is on. ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex3/nhunt-3.out -- 4.7 Кб -- 10.10.2011
Похожие документы
Похожие документы
42. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/rRNA16_part.fasta
>NC_000913.2 NC_000913.2 Escherichia coli str. K-12 substr. MG1655 chromosome, complete genome TCGGGTTGTAAAGTACTTTCAGCGGGGAGGAAGGGAGTAAAGTTAATACCTTTGCTCATT GACGTTACCCGCAGAAGAAGCACCGGCTAACTCCGTGCCAGCAGCCGCGGTAATACGGAG GGTGCAAGCGTTAATCGGAATTACTGGGCGTAAAGCGCACGCAGGCGGTTTGTTAAGTCA GATGTGAAATCCCCGGGCTCAACCTGGGAACTGCATCTGATACTGGCAAGCTTGAGTCTC GTAGAGGGGGGTAGAATTCCAGGTGTAGCGGTGAAATGCGTAGAGATCTGGAGGAATACC
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/rRNA16_part.fasta -- 1.4 Кб -- 10.10.2011
Похожие документы
Похожие документы
43. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/valv_archaea_nhunt.txt
parameters: -e 30 -p 12 -w 4 1 valV embl | AE004437 | AE004437 75 65.33 1 75 103431 103357 - 140.35 3.3165e-05 44.531614 2 valV embl | AE004437 | AE004437 63 71.43 6 68 1877088 1877148 + 138.72 4.6231e-05 44.052418 3 valV embl | AE000782 | AE000782 56 71.43 8 63 1884711 1884766 + 135.22 9.45812e-05 43.019724 4 valV embl | AE004437 | AE004437 57 70.18 18 74 1228886 1228942 + 134.76 0.000103758 42.886131 5 ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/valv_archaea_nhunt.txt -- 30.6 Кб -- 10.10.2011
Похожие документы
Похожие документы
44. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/valv_archaea_fasta.txt
id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score valV embl | AE017261 | AE017261 66.07 56 19 0 63 8 780829 780884 0.029 34.8 valV embl | AE000782 | AE000782 66.10 59 19 1 63 6 73279 73337 0.059 33.7 valV embl | AE004437 | AE004437 82.14 28 5 0 51 24 852827 852854 0.12 32.7 valV embl | AE009441 | ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/valv_archaea_fasta.txt -- 11.0 Кб -- 10.10.2011
Похожие документы
Похожие документы
45. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/thesis.pdf
... Программа для поиска гомологов нуклеотидных последовательностей Пеков Юрий Алексеевич Студент биоинженерии и биоинформатики, Москва, Россия E-mail: yurapekov@gmail.com Секция ?Биоинженерия и биоинформатика? ... Целью настоящей работы было создание компьютерной программы Nhunt для поиска гомологов нуклеотидных последовательностей, превосходящей по чувствительности как программу FASTA, так и программу BLASTN. ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/thesis.pdf -- 91.7 Кб -- 10.10.2011
Похожие документы
Похожие документы
46. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/tRNA_part.fasta
>valV gcgttcatagctcagttggttagagcaccaccttgacatggtgggggtcg ttggttcgagtccaattgaacgcacca >selC ggaagatcgtcgtctccggtgaggcggctggacttcaaatccagttgggg ccgccagcggtcccgggcaggttcgactcctgtgatcttccgcca >asnV tcctctgtagttcagtcggtagaacggcggactgttaatccgtatgtcac tggttcgagtccagtcagaggagcca >leuT gcgaaggtggcggaattggtagacgcgctagcttcaggtgttagtgtcct tacggacgtgggggttcaagtcccccccctcgcacca >argZ gcatccgtagctcagctggatagagtactcggctacgaaccgagcggtcg gaggttcgaatcctcccggatgcacca
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex1/tRNA_part.fasta -- 1.4 Кб -- 10.10.2011
Похожие документы
Похожие документы
47. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/term_2011.pdf
МОСКОВСКИЙ ГОСУДАРСТВЕННЫЙ УНИВЕРСИТЕТ имF МF ВF ЛОМОНОСОВА ФАКУЛЬТЕТ БИОИНЖЕНЕРИИ И БИОИНФОРМАТИКИ Программа для поиска гомологов нуклеотидных последовательностей Курсовая работа студента s курса ЮF АF Пекова Научный руководительX кFфFEмFнFD сFнFсF СF АF Спирин Москва PHII Оглавление 1 Введение 2 Литературный обзор 3 Описание программы QFI QFP QFQ Поиск наилучших диагоналей F F F F F F F F F F F F F F F F F F F F F F F F F F F F Локальное выравнивание для лучших ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/term_2011.pdf -- 308.5 Кб -- 11.09.2011
Похожие документы
Похожие документы
48. http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/poster_mccmb_2011.pdf
... Results Comparison with FASTA archaean genomes. ... But each of these programs has some signicant Table 1: Numb er of found alignments with E-value less than given Program FASTA Nhunt Run time 5.5 1.4 Example alignment : Query: ctgtttaccaggtcaggtccggaaggaagcagccaaggcagatgacgcgt aaaaaaaa||||aa|||||a|a|aaa|||a||aa|| |||||||aa||a|||aa||a| Sbjct: ctgtgaaccagcttatcgccgcaatcaaacagccaaatcatatgcagcat Identity = 33/50 (66%) Strand: Plus/Minus Alignment features without scoring ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/poster_mccmb_2011.pdf -- 225.5 Кб -- 21.07.2011
Похожие документы
Похожие документы
49. S
S .. ... SNP regions in the dataset are 21bp fragments of the genome containing SNP in the middle position . ... Word frequencies in SNP regions of the human genome (zip file, 66 MB) . ... Word frequencies in SNP regions of the human genome (xls file, 1.2 MB) . The file contains the frequency of each word of length 1, 2, 3, 4 or 5 in flanks of SNP regions for several criteria of SNP selection. These frequencies are compared to the frequencies of the same words in the complete human genome . ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/SNP/ -- 4.0 Кб -- 07.05.2011
Похожие документы
Похожие документы
50. S
S .. ... Genomes (xls file, 150 KB) . List of analyzed genomes: 139 full genomes, 35 masked genomes, 33 CDS of genomes . ... Verification of downloaded genome data: genome size in bp is shown, occurencies of each word of 1-7 letters and its complement are compared for all genomes . ... Contrasts of words of 1-7 letters in full genomes according the method of Karlin et al. ... Words of 1-7 letters in full genomes that are under/over-represented in 50% or more genomes from a wide taxonomic group . ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/words/ -- 5.1 Кб -- 06.05.2011
Похожие документы
Похожие документы
51. Comparison of protein phylogeny reconstruction methods
. Set 1: List of species Reference tree . Set 2: List of species Reference tree . Set 3: List of species Reference tree . Set 4: List of species Reference tree . For the set 1 . For the sets 2 4
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/ -- 2.3 Кб -- 05.05.2011
Похожие документы
Похожие документы
52. Example of alignment
Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/tools/example.html -- 1.7 Кб -- 31.01.2011
[ Сохраненная копия ] Ссылки http://mouse.genebee.msu.ru/~sas/example.html -- 1.7 Кб -- 18.03.2010
Похожие документы
[ Сохраненная копия ] Ссылки http://mouse.genebee.msu.ru/~sas/example.html -- 1.7 Кб -- 18.03.2010
Похожие документы
53. http://mouse.genebee.msu.ru/phylogeny/Tables.doc
Set 1 |Average |Median |> 18 |< 12 |? max - 1 |< max - 2 | X - fitch | X- proml | ... fitch Kim. |16.9 |17 |40 |4 |41 |36 |6 |18 |0.02 |60 |7 |1•10-11 |0.15 |1.93 | fitch diff. ... PhyML D |16.1 |16 |21 |10 |20 |62 |6 |50 |1•10-9 |42 |7 |4•10-7 |0.42 |6.7 | ... promlk |13.9 |14 |2 |19 |6 |92 |3 |87 |2•10-22 |27 |41 |0.11 |0.31 |104.2 | ... FastME |16.8 |17 |15 |7 |37 |26 |10 |16 |0.33 |34 |10 |4•10-4 |0.51 |1.3 | ... promlk |8.9 |9 |16 |3 |46 |14 |8 |17 |0.11 |25 |7 |2•10-3 |0.31 | ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Tables.doc -- 159.0 Кб -- 27.04.2010
Похожие документы
Похожие документы
54. http://mouse.genebee.msu.ru/phylogeny/Species_set4.doc
... Archaeoglobus fulgidus DSM 4304 ARCFU Aeropyrum pernix K1 AERPE Desulfurococcus kamchatkensis 1221n DESK1 Korarchaeum cryptofilum OPF8 KORCO Halorubrum lacusprofundi ATCC 49239 HALLT Haloarcula marismortui ATCC 43049 HALMA Halomicrobium mukohataei DSM 12286 HALMD Haloquadratum walsbyi DSM 16790 HALWD Ferroglobus placidus FERPL Methanococcoides burtonii ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Species_set4.doc -- 25.0 Кб -- 14.04.2010
Похожие документы
Похожие документы
55. http://mouse.genebee.msu.ru/phylogeny/Species_set3.doc
... Caldivirga maquilingensis IC-167 CALMQ Methanoregula boonei 6A8 METBU Hyperthermus butylicus DSM 5456 HYPBU Halobacterium salinarum R1 HALS3 Halorhabdus utahensis DSM 12940 HALUD Ignicoccus hospitalis KIN4/I IGNH4 Methanosarcina acetivorans C2A METAC Methanococcus aeolicus Nankai-3 META3 Cenarchaeum ... Methanospirillum hungatei JF-1 METHJ Methanopyrus kandleri AV19 METKA Methanoculleus marisnigri JR1 METMJ Metallosphaera sedula DSM ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Species_set3.doc -- 25.0 Кб -- 14.04.2010
Похожие документы
Похожие документы
56. http://mouse.genebee.msu.ru/phylogeny/Species_set2.doc
... Archaeoglobus fulgidus DSM 4304 ARCFU Aeropyrum pernix K1 AERPE Caldivirga maquilingensis IC-167 CALMQ Methanoregula boonei 6A8 METBU Desulfurococcus kamchatkensis 1221n DESK1 Korarchaeum cryptofilum OPF8 KORCO Hyperthermus butylicus DSM 5456 HYPBU Halorubrum lacusprofundi ATCC 49239 HALLT Haloarcula marismortui ATCC 43049 HALMA Halomicrobium mukohataei DSM 12286 HALMD Halobacterium salinarum R1 HALS3 Halorhabdus utahensis DSM ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Species_set2.doc -- 27.5 Кб -- 14.04.2010
Похожие документы
Похожие документы
57. http://mouse.genebee.msu.ru/phylogeny/Species_set1.doc
... 638 ENT38 Erwinia tasmaniensis strain ET1/99 ERWT9 Escherichia coli 536 ECOL5 Salmonella enterica subsp. enterica serovar Agona SALA4 Yersinia pestis Angola YERPG Vibrio cholera M66-2 VIBCH Pasteurella multicode subsp. multicode str. Pm 7 PASMU Myxococcus xanthus DK 1622 MYXXD Helicobacter pylori 26695 HELPY Campylobacter concisis 13826 CAMC1 Firmicutes: Staphylococcus aureus RF122 STAAB Bacillus subtilis subsp. subtilis str. 168 BACSU Bacillus anthracis str. ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Species_set1.doc -- 27.0 Кб -- 14.04.2010
Похожие документы
Похожие документы
58. http://mouse.genebee.msu.ru/phylogeny/Domains_sets2-4.doc
The list of Archaea domains composed the orthologuos groups of the set 2, 3 and 4 Pfam AC Pfam ID Description PF00164 Ribosomal _S12 Ribosomal protein S12 PF00177 Ribosomal _S7 Ribosomal protein S7p/S5e PF00181 Ribosomal _L2 Ribosomal Proteins L2, RNA binding domain PF00189 Ribosomal _S3_C Ribosomal protein S3, C-terminal domain PF00203 Ribosomal _S19 Ribosomal ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Domains_sets2-4.doc -- 32.5 Кб -- 14.04.2010
Похожие документы
Похожие документы
59. http://mouse.genebee.msu.ru/phylogeny/Domains_set1.doc
list of Eubacteria domains composed the orthologuos groups of the set 1 Pfam AC Pfam ID Description PF00035 dsrm Double-stranded RNA binding motif PF00113 Enolase_C Enolase, C-terminal TIM barrel domain PF00119 ATP-synt_A ATP synthase A chain PF00162 PGK Phosphoglycerate kinase PF00164 Ribosomal _S12 Ribosomal protein S12 PF00177 Ribosomal _S7 Ribosomal protein S7p/S5e PF00181 Ribosomal _L2 Ribosomal Proteins L2, ...
[
Текст
]
Ссылки http://mouse.genebee.msu.ru/phylogeny/Domains_set1.doc -- 31.0 Кб -- 14.04.2010
Похожие документы
Похожие документы
60. Geometrical core
... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...
[
Сохраненная копия
]
Ссылки http://mouse.genebee.msu.ru/~sas/gc.html -- 4.2 Кб -- 18.03.2010
Похожие документы
Похожие документы