... file . ... annotate . ... dendik@890 . ... 8 blocks3d /wt/ blocks3d - wt . ... 9 debian /. dep . ... 21 allpy /data/ codes . ... 25 blocks3d /www/input/ conservative_groups . ... 26 blocks3d /www/input/ crc32 . ... 27 blocks3d /www/input/ utf8_encode . ... 28 blocks3d /www/input/ dechex . ... 29 blocks3d /www/input/ json2 . ... 30 blocks3d /wt/files/ js . ... 31 blocks3d /wt/files/ resources . ... 33 pair_cores / html . ... 43 # Temporary files from debianization . ... 62 # Input files for tests . ...

Еще в разделе: (Показать все результаты (>112871) - kodomo.fbb.msu.ru/ )

• allpy: Makefile annotate
• allpy: debian/rules annotate
• allpy: NEWS annotate

... annotate . ... ksenia_yashina@23 . ... 2 <title> Petri dish </title> . ... 7 Simulation of life inside Petri dish, where hypothetic unicellular organisms move and reproduce. ksenia_yashina@23 . ... 13 <li> Asexual reproduction - division of parent cell, which leads to formation of two identical daughter cells; parent cell disappears; no division occurs if there is not enough space to place daughter cells in dish </li> . ... 24 Number of cells [1-10] - number of cells in dish at start of simulation ....

Еще в разделе: (Показать все результаты (>4104) - kodomo.cmm.msu.ru/ )

• petri_dish: bacteria.py annotate
• petri_dish: tk1.py annotate
• petri_dish: Bacteria.py annotate

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>262) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>125) - www.genebee.msu.ru/ )

• TreeTop - Phylogenetic Tree prediction
• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

1 Faculty of Physics, Moscow State University, Moscow 119899, Russia; 2 Soil Science Faculty, Moscow State University, Moscow 119899, Russia . ... To estimate soil response to acid deposition we compared the soil field data along a pollution gradient and simulated time effects. ... Time response of soils to acid deposition was evaluated with the SMART model. According to field observations there is no evidence for strong soil acidification effects close to the smelter. ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• Koptsik G.N., et al. Response of pine forests to long-term air pollution at the
• CRITICAL LOADS OF ACID DEPOSITION FOR FORESTS
• EFFECTS OF ACID DEPOSITION ON ACIDITY IN PODZOLS

Электронная библиотека Попечительского совета . ... Gass S. I., Assad A.A. - An Annotated Timeline of Operations Research: An Informal History . ... Название: An Annotated Timeline of Operations Research: An Informal History . Авторы: Gass S. I., Assad A.A. Аннотация: . An Informal History recounts the evolution of Operations Research (OR) as a new science - the science of decision making. ... The Timeline chronicles the history of OR in the form of self-contained, expository entries. ...

Еще в разделе: (Показать все результаты (>3160) - lib.mexmat.ru/ )

• Поиск книг, содержащих BibTeX'овский стиль, annotate :: Электронная библиотека
• Friedman A., Klander L., Michaelis M. - C/C++ Annotated Archives :: Электронная
• Поиск книг, содержащих annotate, BibTeX'овский стиль :: Электронная библиотека

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>140) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/42.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/236.pdf

... 2016-Jan-25 18:28:47 . ... application/octet-stream . ... 0.6K . text/plain . ... text/xml . ...

Еще в разделе: (Показать все результаты (>10813) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-java/jackson-module-jaxb-annotations/
• Index of /pub/gentoo-portage/dev-java/myfaces-builder-annotations/
• Index of /pub/gentoo-portage/dev-java/jcip-annotations/

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

GDE . The GDE (Genetic Data Environment) is a set of programs for multiple sequence alignment and analysis. The programs use an expandable user interface which allows the addition of external analysis functions without any rewriting of code. ... ftp://ftp.bmc.uu.se/pub/linnaeus/software/gde/ . Source Code Availability: Yes . ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>410) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign
• CGFA- New Additions (1999)
• CGFA- New Additions (1998)

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• SDPlight
• Alignment example
• SDPpred

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>23) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>213) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBoxLayout Class
• Qt Toolkit - QLabel Class

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>121) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>26) - num-meth.srcc.msu.ru/ )

... Menu Command Operations/ Image Operation/ Add , Subtract and Advanced allow to add or subtract images. ... If the Commands Add or Subtract was in process, the image subtraction or addition will be performed at once. It is regarded that left lower corners of the images coincides, the new height of each point in the resultant image will be equal to half of the sum or to half of the difference of the points height of the initial images. Figure: Dialogue for Image Addition and Subtraction. ...

Еще в разделе: (Показать все результаты (>21) - www.spm.genebee.msu.ru/ )

• Calculation of the Volume, restricted by the isoline

. [ Войти ] . Главная -> Фильмы -> Addition, L' . Пользователи . Демо . Деньги . Фильмы . Форум . Addition, L' . Франция 1984 . отметить . Триллер . Драма .

Еще в разделе: (Показать все результаты (>3) - kinfo.ru/ )

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TablePlugin 10 - 2002-03-07 - PeterThoeny . ... Table cell spacing. ... Set CELLSPACING = 1 . ... 05 Jan 2002 PTh: Fixed sorting bug of cells with leading white space . 06 Dec 2001 PTh: Fixed date sorting bug . 03 Dec 2001 PTh: Fixed sort="off" bug and more . 29 Nov 2001: PTh fixed Perl warnings . 16 Nov 2001: PTh added table border, cell spacing, cell padding, gif files . ...

Еще в разделе: (Показать все результаты (>26727) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (3 vs. 4) - TWiki
• %TOPICTITLE% (17 vs. 18) - TWiki
• %TOPICTITLE% (14 vs. 15) - TWiki