. аљб?аКаОаВаОаДб?б?аВаО аПаОаЛб?аЗаОаВаАб?аЕаЛб? Gnumeric . Prev . Next . RATE -- . RATE(nper,pmt,pv[,fv,type,guess]) . аДа?б?аЗа?б?а? RATE б?б?аВб?а?аПа?аПб?а? б?а?б?а?б?б?а?б?а?а? а?а?аПб?аЗа? б?а?б? б?а?б?б?аПа?б? а?б?б?а?а?. PV , FV . Prev . Home . Next . RANK . Up . RECEIVED

Еще в разделе: (Показать все результаты (>885) - uneex.lorien.cs.msu.su/ )

• CUMIPMT
• CUMPRINC
• ISPMT

. [ Prev ] [ Index ] [ Next ] . Animation . Mask . Result . The first animation was created in the previous step . The second image was easy to create: I cleared the center of a white image, blurred the result a bit, added our good friend Wilber in the corner, and finally some text at the bottom. After the merge, the animation is seen through the transparent areas in the mask. [ Prev ] [ Index ] [ Next ]

Еще в разделе: (Показать все результаты (>1292) - www.sai.msu.su/ )

• FTS Parser Example
• FTS Dictionary Example
• GIMP animations: merge-anim example 3

... The previous example, Chapter 12, "Expanding Colored Squares Example," illustrates how to expand and contract the clipping region of a layer without changing the wrapping width of the layer. This example illustrates how to capture mouse events so that the user can make a layer's wrapping width wider or narrower by dragging the mouse. ... how to capture mouse events for a layer . how to change the wrapping width of a layer by using the load() function . ... Capturing Events for the Layer . ...

Еще в разделе: (Показать все результаты (>37179) - crydee.sai.msu.ru/ )

• Image: Interesting example of building wall. No windows. Hmmm...
• Image: Another example of near-house decorations
• Image: Another fine example of typical roof. Still don't know exactly what it

... Classes and Objects . Next . ... The :: operator is being used for this. class A { function example () { echo I am the original function A:: example (). br \n ; } } class B extends A { function example () { echo I am the redefined function B:: example (). br \n ; A:: example (); } } // there is no object of class A. // this will print // I am the original function A:: example (). br A:: ... There are class functions, but there are no class variables. ...

Еще в разделе: (Показать все результаты (>2987) - oit.cmc.msu.ru/ )

• Bzip2 Compression Functions
• sprintf
• Class/Object Functions

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

XML-RPC HOWTO . Prev . Chapter 9. Applications with Built-in XML-RPC Support . Next . KDE 2.0 includes Kurt Ganroth's kxmlrpc daemon , which allows you to script KDE applications using XML-RPC. Here's a short sample application in Python. It shows you how to connect to kxmlrpc, manipulate your KDE address book, and query the KDE trader. If you have any other articles or example code, please see Chapter 10 . We'd like to have more information on scripting KDE. ...

Еще в разделе: (Показать все результаты (>603) - rtm-cs.sinp.msu.ru/ )

• Sample API: sumAndDifference
• Submitting Other Snippets
• Apache module mod_example

... About lab . ... MSU Graphics & Media Lab (Video Group) . Algorithm allows to double frame rate (fps) of the video stream. ... D.Vatolin, S.Grishin, "Video Frame Rate Conversion Method Based on Compensated Frames Interpolation", "New Information Technologies in Automated Systems" Seminar at M.V.Keldysh Institute of Applied Mathematics (2006). ... D.Vatolin, S.Grishin, "Double Up-conversion of Video Frame Rate Based on Two-Dimensional Motion Compensation", "Programming" Magazine (2006). ...

Еще в разделе: (Показать все результаты (>179) - graphics.cs.msu.ru/ )

• Video Frame Rate Double Up-Conversion | Лаборатория компьютерной графики и
• Video Frame Rate N-Times Up-Conversion | Graphics and Media Lab
• Video Frame Rate N-Times Up-Conversion | Лаборатория компьютерной графики и

You are here: Foswiki > System Web > JQueryPlugin > JQueryRating (22 Sep 2010, ProjectContributor ) E dit A ttach . ... When you hover over the stars, a tooltip at the right side will display the value of the radio box, or the title if present. ... Name . ... STARTSECTION{ markup }% div class = jqRating input type= radio name = test value = 1 class = rating title = very low / input type= radio name = test value = 2 class = rating title = low / input type= radio ...

Еще в разделе: (Показать все результаты (>6512) - wiki.cmc.msu.ru/ )

... To add a theme dropdown to the page (top right), write: %JQREQUIRE{"themeswitcher"}% . ... Error: no such plugin themeswitcher . ... Choice 1 Choice 2 Choice 3 . ... December 2010 . ... Sample ui-state-highlight style. Alert: Sample ui-state-error style. This topic: System > JQueryPlugin > JQueryThemeSwitcher . ... Copyright by the contributing authors. All material on this site is the property of the contributing authors. Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>2104) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki

... Using Disks and Other Storage Media . ... Many floppies are used in a tape-drive emulating fashion, so that a tar or other file is written directly on the raw disk, without a filesystem. ... One way to do this is to use dd : $ dd if=/dev/fd0H1440 of=floppy-image 2880+0 records in 2880+0 records out $ dd if=floppy-image of=/dev/fd0H1440 2880+0 records in 2880+0 records out $ The first dd makes an exact image of the floppy to the file floppy-image , the second one writes the image to the floppy. ...

Еще в разделе: (Показать все результаты (>462) - itpm.msu.su/ )

• Special configuration in /etc/inittab
• Emergency boot floppies
• Disabling a user temporarily

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>204) - angel.cs.msu.su/ )

• : Package ucar.multiarray
• : Package ucar.netcdf
• API Help

... Of course, you need to have iwconfig installled on your system. ... matching is done on the first 3 bytes of the MAC address # SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter 00:04:E2:*) INFO = SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter # ESSID (extended network name) : My Network, any ESSID = any # NWID/Domain (cell identifier) : 89AB, 100, off NWID= # Operation mode : Ad-Hoc, Managed, Master, Repeater, Secondary, auto MODE = Managed # Frequency or ...

Еще в разделе: (Показать все результаты (>18432) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/net-p2p/bitcoind/bitcoind-0.12.0.ebuild
• http://mirror.msu.net/pub/slackware-current/slackware/l/libsamplerate-0.1.8-i486-1.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc978.txt

... Client/Server Examples . ... Up: Client/Server Examples Next: Ocean/Atmosphere - Relies on Name Publishing Previous: Client/Server Examples . The following example shows the simplest way to use the client/server interface. ... Up: Client/Server Examples Next: Simple Client-Server Example. ... MPI_Open_port(MPI_INFO_NULL, port_name); MPI_Publish_name("ocean", MPI_INFO_NULL, port_name); . ... MPI_Comm_connect( port_name, MPI_INFO_NULL, 0, MPI_COMM_WORLD, &server ); . ... Центры . ...

Еще в разделе: (Показать все результаты (>632) - www.parallel.ru/ )

• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по

... Line: 1 to 1 . Changed: . This Plugin converts a topic with headings into a slide show. This plugin converts a topic with headings into a slideshow. ... This Plugin makes sense for organizations that do already have lots of content in TWiki: It is easy to create a web based presentation that contains many links to related content. ... Use the optional template parameter to specify your own slide template topic, e.g. %SLIDESHOWSTART{ template="MyOwnSlideTemplate" }% . ... Plugin topic . ...

Еще в разделе: (Показать все результаты (>39806) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• SlideShowPlugin < TWiki < TWiki

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>97) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>6) - storage.bioinf.fbb.msu.ru/ )

. Электронная библиотека . механико-математического факультета . Московского государственного университета . Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . Мехматянам . Первый курс . Второй курс . Третий курс . Четвертый курс . Пятый курс . Поиск по указателям . Журнал Probability and Statistics by Example . 1. Probability and statistics by example (?1 2005) . Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . | | О проекте

Еще в разделе: (Показать все результаты (>8147) - lib.mexmat.ru/ )

• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная
• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Поиск книг, содержащих Counter example :: Электронная библиотека

... line source . ... 4 from repeat_joiner import Interval , RepeatJoiner . ... 7 for line in open ( sys . ... 8 line = line . ... 9 if line : . 10 c1 , c2 , from1 , to1 , from2 , to2 , ori1 , ori2 = line . ... 12 continue # first line . 13 ori1 = True if int ( ori1 ) == 1 else False . ... 15 from1 = int ( from1 ) . ... 17 from2 = int ( from2 ) . ... 20 r1 = Interval ( rj , c1 , from1 , to1 , ori1 ) . 21 r2 = Interval ( rj , c2 , from2 , to2 , ori2 ) . ... 32 for interval in interval_group : . ...

Еще в разделе: (Показать все результаты (>6841) - kodomo.fbb.msu.ru/ )

• allpy: 934d52e3181b repeats/test.py
• allpy: a514dd131bf4 repeats/test.py
• allpy: 7194066a3621 repeats/test.py

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>28) - www.intsys.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>50) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.