To get an overview of section 1 (one) of the manual: man 1 intro . ... This displays a one line synopsis of each command that has this keyword in its description. To search the online manual for a command with the phrase "copy files": man -k 'copy files' . ... To check what a command does: whatis more more, page (1) - browse or page through a text file . ... To display the manual page for the cp (copy files) command: man cp . ... To print the manual page for the man command: man -t man . ...

Еще в разделе: (Показать все результаты (>474) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Example of changing a password with the passwd command
• Examples of creating files

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2398) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, with Rolex, showing
• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>729) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1406) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>188) - uneex.mithril.cs.msu.su/ )

• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• HelpOnMoinCommand/ExportDump - UNИX
• Index of /static/GimpDoc_EnRu/images/filters/examples

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>3) - www.sciencepark.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... The application methods of complex professional benchmarking are discussed; it is also shown how these methods are used in the rating and engineering design of supercomputers. ... Keywords: rating list benchmarking, complex test benchmarking, data intensive systems, multilevel benchmarking, space-temporal memory reference locality, memory reference delay optimization, memory reference tolerate, delay hiding, run-time systems, multithreaded architecture program emulation . ...

Еще в разделе: (Показать все результаты (>139) - num-meth.srcc.msu.ru/ )

• "An algorithm for detection of intersections between polygonal objects by
• "A quasi-3D model of a polymer electrolyte fuel cell"
• "An algorithm with optimal convergence rate for solving Fredholm equations of

... Figure: Massive binary evolutionary track. ... A short glance to this track is sufficient to understand that there are a lot of evolutionary scenario parameters, which affect different stages of the binary evolution. Fortunately, a very limited number of parameters has effect on the compact binary merging rate. ... The most important (and practically unique) parameter changing the galactic binary NS merging rate is the distribution of an additional (kick) velocity imparted to NS at birth. ...

Еще в разделе: (Показать все результаты (>487) - xray.sai.msu.ru/ )

• Seminars

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>528) - zmmu.msu.ru/ )

... Which substance can enter redox reaction with FeCl 3 and exchange reaction with AgNO 3 ? Write both reactions. (2 points) [Solution] . ... Write two S E reactions with the least active substance. (2 points) [Solution] . ... Write the reactions involved in the following sequence of transformations: . Determine the functional groups X and Y. Specify the conditions of all reactions. (3 points) [Solution] . ... Example Problems in Chemistry for the Entrance Exams ( preliminary round ) . ...

Еще в разделе: (Показать все результаты (>297) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 47, No. 3, P. 168 (2006)
• Client-side Clickable Image Example
• Entrance Examinations - Preliminary Round

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>49) - hist.msu.ru/ )

... The View Near a Black Hole . ... Credit: April Hobart, CXC Explanation: In the center of a swirling whirlpool of hot gas is likely a beast that has never been seen directly: a black hole . ... What physical mechanisms actually cause the flickering -- and a slower quasi-periodic oscillation (QPO) -- in accretion disks surrounding black holes and neutron stars remains a topic of much research. ... April . ... Publications with keywords: black hole - accretion disk . ... Binary Black Hole in 3C 75 . ...

Еще в разделе: (Показать все результаты (>3533) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"

... Subject : NEW FARM RESOLUTION (From RUSAG conference) . ... This material is from RUSAG conference. ... First, as Deputy Prime Minister Alexander Zaveryukha noted, the government is sticking to its plan to spend the 13.1 trillion rubles already allocated in the farm budget for 1996. ... In addition, the authors of the resolution argue, that with increased government backing, farmers will be able to produce 9 million tons of meat and chicken, 34 million tons of milk, and 32 billion eggs. ...

Еще в разделе: (Показать все результаты (>113) - www.fadr.msu.ru/ )

• Abstracts
• Jennifer Abel COMMENTS ON PAPERS
• Отклик на статью Никольского (М. Гаранджа)

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>50) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>17) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

ИНФОРМАЦИЯ О БОЛЬШОМ СЕМИНАРЕ . ... РАН, профессор А.Н. Ширяев) . ... Term Structures of Interest Rates with Levy Processes as Driving Terms. ... Координаторами Большого кафедрального семинара на осенний семестр 2004 года назначены профессор Тюрин Юрий Николаевич и доцент Болдин Михаил Васильевич. Ученым секретарем Большого кафедрального семинара на весенний семестр 2004 года назначен Медведев Илья Николаевич (e-mail: medvedev@mech.math.msu.su). ...

Еще в разделе: (Показать все результаты (>25) - new.math.msu.su/ )

... The 1973 eruption on the island of Heimaey is a classic example of the struggle between man and volcanoes. With a heroic effort the people of Iceland saved the town of Vestmannaeyjar and the country's most important fishing port. ... The island of Heimaey with the growth of the island in 1973, the location of the eruptive fissure, and the location of Eldfell, the 1973 cone. ... View of Heimaey before the eruption. ... Eldfell and the 1973 lava flows are just beyond the town. ...

Еще в разделе: (Показать все результаты (>218) - geo.web.ru/ )

• Фотографии с Грушинского фестиваля 1999
• Все о геологии :: ChemEl 1.0
• Cambridge, July 1999